@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu04640: (2016-06-07 )
MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAYGHGDAETAKAALDAGASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQEAARHTKKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFLMQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADMSDEIPFQLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILVKGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACTISSRVPRMFLENGSIMEVRNPLLQVNISN

Atome Classification :

(31 SA) .........10..-......20........30...--.--....40........50......-..60........70........80........90........100.......110..---.---.-...-120-.-.----..---.....130.......140...-.-.-...150.-.--..--...160.......170.......180.......190--.-.---....---.200-.........210.---......220.......230.....-..240.......250.......260.......270.......280.......290...-.-.-..300.......310.......320.---.-......330.......340.......350.......360.......370.......380.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSTKPFYRDTWAE-IDLSAIKENVSNMKKHIGEHV--H--LMAVVKANAYGHGDAETAKAAL-DAGASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQ---E---A-ARH-T---K-K----GS---LHFHLKVDTGMNRLGVK-TEE-E-V-QNVMAIL-D--RN--PRLKCKGVFTHFATADEKERGYFLMQFERFKELIAP--L-P---LKNL---MV---HCANSAAGLRLKK---GFFNAVRFGIGMYGLRPSADMSDE-IPFQLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKG-T-D-ILVKGKRLKIAGRICMDQFMVEL-DQ---E-YPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACTISSRVPRMFLENGSIMEVRNPLLQVNISN
5 PsiBlast_PDB 91.9450%-136 - C1 -3HA1 ? A:[4-386] ---APFYRDTWVE-VDLDAIYNNVTHIKEFIPSDV--E--IFAVVKGNAYGHDYVPVAKIAL-EAGATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVALTVFQKEWVD---E---A-IKL-W---D-G----SST--MKYHINFDSGMGRIGIR-ERK-E-L-KGFLKSL-E--GA--PFLELEGVYTHFATADEVETSYFDKQYNTFLEQLSW--L-KEFGVDPK---FV---HTANSAATLRFQG---ITFNAVRIGIAMYGLSPSVEIRPF-LPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEWIATVAIGYADGWLRRLQG-F-E-VLVNGKRVPIVGRVTMDQFMIHL-PC---E-VPLGTKVTLIGRQGDEYISATEVAEYSGTINYEIITTISFRVPRIFIRNGKVVEVINYL-------
1 PsiBlast_PDB 89.6556%-131 - C1 -1SFT ALR_GEOSE A:[4-379] -----FHRDTWAE-VDLDAIYDNVENLRRLLPDDT--H--IMAVVKANAYGHGDVQVARTAL-EAGASRLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLE---E---ASALY-S---G-P----FP---IHFHLKMDTGMGRLGVK-DEE-E-T-KRIVALI-E--RH--PHFVLEGLYTHFATADEVNTDYFSYQYTRFLHMLEW--L-P---SRPP---LV---HCANSAASLRFPD---RTFNMVRFGIAMYGLAPSPGIKPL-LPYPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQH-F-H-VLVDGQKAPIVGRICMDQCMIRL-PG---P-LPVGTKVTLIGRQGDEVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRN---------
21 PsiBlast_CBE 89.3456%-126 - C1 -1SFT ALR_GEOSE B:[4-379] -----FHRDTWAE-VDLDAIYDNVENLRRLLPDDT--H--IMAVVKANAYGHGDVQVARTAL-EAGASRLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLE---E---ASALY-S---G-P----FP---IHFHLKMDTGMGRLGVK-DEE-E-T-KRIVALI-E--RH--PHFVLEGLYTHFATADEVNTDYFSYQYTRFLHMLEW--L-P---SRPP---LV---HCANSAASLRFPD---RTFNMVRFGIAMYGLAPSPGIKPL-LPYPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQH-F-H-VLVDGQKAPIVGRICMDQCMIRL-PG---P-LPVGTKVTLIGRQGDEVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRN---------
2 PsiBlast_PDB 88.4456%-128 - C1 -1BD0 ALR_GEOSE A:[4-379] -----FHRDTWAE-VDLDAIYDNVENLRRLLPDDT--H--IMAVVKANAYGHGDVQVARTAL-EAGASRLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLE---E---ASALY-S---G-P----FP---IHFHLKMDTGMGRLGVK-DEE-E-T-KRIVALI-E--RH--PHFVLEGLYTHFATADEVNTDYFSYQYTRFLHMLEW--L-P---SRPP---LV---HCANSAASLRFPD---RTFNMVRFGIAMYGLAPSPGIKPL-LPYPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQH-F-H-VLVDGQKAPIVGRICMDQCMIRL-PG---P-LPVGTKVTLIGRQGDEVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRN---------
22 PsiBlast_CBE 87.6856%-127 - C1 -1BD0 ALR_GEOSE B:[4-379] -----FHRDTWAE-VDLDAIYDNVENLRRLLPDDT--H--IMAVVKANAYGHGDVQVARTAL-EAGASRLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLE---E---ASALY-S---G-P----FP---IHFHLKMDTGMGRLGVK-DEE-E-T-KRIVALI-E--RH--PHFVLEGLYTHFATADEVNTDYFSYQYTRFLHMLEW--L-P---SRPP---LV---HCANSAASLRFPD---RTFNMVRFGIAMYGLAPSPGIKPL-LPYPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQH-F-H-VLVDGQKAPIVGRICMDQCMIRL-PG---P-LPVGTKVTLIGRQGDEVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRN---------
48 HHSearch 86.3754%-131 - C1 -1BD0 ALR_GEOSE A:[4-382] ------FHRDTWAEVDLDAIYDNVENLRRLLPDDT--H--IMAVVKANAYGHGDVQVAR-TALEAGASRLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLE-------E-ASALYS--G-P----FP---IHFHLKMDTGMGRLGVK-D-E-EET-KRIVALI-E--RH--PHFVLEGLYTHFATADEVNTDYFSYQYTRFLHMLEW--L-P---SRPP---LV---HCANSAASLRFPD---RTFNMVRFGIAMYGLAPSPGI-KPLLPYPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQH-F-H-VLVDGQKAPIVGRICMDQCMIRL-PG---P-LPVGTKVTLIGRQGDEVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRNAIG------
4 PsiBlast_PDB 86.1951%-138 - C1 -3UW6 - ALR_GEOSE A:[4-379] -----FHRDTWAE-VDLDAIYDNVENLRRLLPDDT--H--IMASVCGNAYGHGDVQVARTAL-EAGASRLAVAFLDEALALREKGIEAPILVTGASRPADAALAAQQRIALTVFRSDWLE---E---ASALY-S---G-P----FP---IHFHLYMDTGMGSLGVK-DEE-E-T-KRIVALI-E--RH--PHFVLEGLWTWFAT-------YFSYQYTRFLHMLEW--L-P---SRPP---LV---HCANSAASLRFPD---RTFNMVQFGIAMYGLAPSPG------PYPLKEAFSLHSRLVHVKKLQPGEKVSFGATYTAQTEEWIGTIPIGYKDGWLRRLQH-F-H-VLVDGQKAPIVGRILGDMCMIRL-PG---P-LPVGTKVTLIGRQGDKVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRN---------
3 PsiBlast_PDB 86.0253%-143 - C1 -4ILS - ALR_GEOSE A:[4-379] -----FHRDTWAE-VDLDAIYDNVENLRRLLPDDT--H--IMASVCGNAYGHGDVQVARTAL-EAGASRLAVAFLDEALALREKGIEAPILVTGASRPADAALAAQQRIALTVFRSDWLE---E---ASALY-S---G-P----FP---IHFHLYMDTGMG---VK-DEE-E-T-KRIVALI-E--RH--PHFVLEGLWTWF------------YQYTRFLHMLEW--L-P---SRPP---LV---FCAN---SLR------RTFNMVQFGIAMYGLA-----------YPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYKDGWLRRLQH-F-H-VLVDGQKAPIVGRILMDMCMIRL-PG---P-LPVGTKVTLIGRQGDKVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRN---------
26 PsiBlast_CBE 80.9245%-122 - C1 -3E5P ? B:[5-370] -----WHRPTRLH-IDTQAITENVQKECQRLPEGT--A--LFAVVKANGYGHGAVESAKAAK-KGGATGFCVALLDEAIELREAGVQDPILILSVVDLAYVPLLIQYDLSVTVATQEWLE---A---A-LQQ-L---T-P----ESNTPLRVHLKVDTGMGRIGFL-TPE-E-T-KQAVRFV-Q--SH--KEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAV--L-E---ELPR---YV---HVSNSATALWHPD---VPGNMIRYGVAMYGLNPSGNKLAP--SYALKPALRLTSELIHVKRLAAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQG-F-T-VLVNGKRCEIVGRVCMDQCMIRL-AE---E-VPVGPVVTLVGKDGNEENTLQMVAEKLETIHYEVACTFSQRIPREY--------------------
25 PsiBlast_CBE 80.8545%-123 - C1 -3E5P ? C:[5-370] -----WHRPTRLH-IDTQAITENVQKECQRLPEGT--A--LFAVVKANGYGHGAVESAKAAK-KGGATGFCVALLDEAIELREAGVQDPILILSVVDLAYVPLLIQYDLSVTVATQEWLE---A---A-LQQ-L---T-P----ESNTPLRVHLKVDTGMGRIGFL-TPE-E-T-KQAVRFV-Q--SH--KEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAV--L-E---ELPR---YV---HVSNSATALWHPD---VPGNMIRYGVAMYGLNPSGNKLAP--SYALKPALRLTSELIHVKRLAAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQG-F-T-VLVNGKRCEIVGRVCMDQCMIRL-AE---E-VPVGPVVTLVGKDGNEENTLQMVAEKLETIHYEVACTFSQRIPREY--------------------
24 PsiBlast_CBE 80.6145%-122 - C1 -3E6E ? B:[5-370] -----WHRPTRLH-IDTQAITENVQKECQRLPEGT--A--LFAVVKANGYGHGAVESAKAAK-KGGATGFCVALLDEAIELREAGVQDPILILSVVDLAYVPLLIQYDLSVTVATQEWLE---A---A-LQQ-L---T-P----ESNTPLRVHLKVDTGMGRIGFL-TPE-E-T-KQAVRFV-Q--SH--KEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAV--L-E---ELPR---YV---HVSNSATALWHPD---VPGNMIRYGVAMYGLNPSGNKLAP--SYALKPALRLTSELIHVKRLAAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQG-F-T-VLVNGKRCEIVGRVCMDQCMIRL-AE---E-VPVGPVVTLVGKDGNEENTLQMVAEKLETIHYEVACTFSQRIPREY--------------------
23 PsiBlast_CBE 80.2645%-124 - C1 -3E6E ? C:[5-370] -----WHRPTRLH-IDTQAITENVQKECQRLPEGT--A--LFAVVKANGYGHGAVESAKAAK-KGGATGFCVALLDEAIELREAGVQDPILILSVVDLAYVPLLIQYDLSVTVATQEWLE---A---A-LQQ-L---T-P----ESNTPLRVHLKVDTGMGRIGFL-TPE-E-T-KQAVRFV-Q--SH--KEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAV--L-E---ELPR---YV---HVSNSATALWHPD---VPGNMIRYGVAMYGLNPSGNKLAP--SYALKPALRLTSELIHVKRLAAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQG-F-T-VLVNGKRCEIVGRVCMDQCMIRL-AE---E-VPVGPVVTLVGKDGNEENTLQMVAEKLETIHYEVACTFSQRIPREY--------------------
6 PsiBlast_PDB 79.5745%-122 - C1 -3E5P ? A:[5-370] -----WHRPTRLH-IDTQAITENVQKECQRLPEGT--A--LFAVVKANGYGHGAVESAKAAK-KGGATGFCVALLDEAIELREAGVQDPILILSVVDLAYVPLLIQYDLSVTVATQEWLE---A---A-LQQ-L---T-P----ESNTPLRVHLKVDTGMGRIGFL-TPE-E-T-KQAVRFV-Q--SH--KEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAV--L-E---ELPR---YV---HVSNSATALWHPD---VPGNMIRYGVAMYGLNPSGNKLAP--SYALKPALRLTSELIHVKRLAAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQG-F-T-VLVNGKRCEIVGRVCMDQCMIRL-AE---E-VPVGPVVTLVGKDGNEENTLQMVAEKLETIHYEVACTFSQRIPREY--------------------
53 HHSearch 79.3946%-123 * C1 *3E5P ? A:[3-371] ---VGWHRPTRLH-IDTQAITENVQKECQRLPEGT--A--LFAVVKANGYGHGAVESAK-AAKKGGATGFCVALLDEAIELREAGVQDPILILSVVDLAYVPLLIQYDLSVTVATQEWLE-------A-ALQQLTPES-N----TP---LRVHLKVDTGMGRIGFL-T-PEE-T-KQAVRFV-Q--SH--KEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAV--L-E---ELPR---YV---HVSNSATALWHPD---VPGNMIRYGVAMYGLNPSGNK-LA-PSYALKPALRLTSELIHVKRLAAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQG-F-T-VLVNGKRCEIVGRVCMDQCMIRL-AE---E-VPVGPVVTLVGKDGNEENTLQMVAEKLETIHYEVACTFSQRIPREYN-------------------
7 PsiBlast_PDB 78.7045%-118 - C1 -3E6E ? A:[5-370] -----WHRPTRLH-IDTQAITENVQKECQRLPEGT--A--LFAVVKANGYGHGAVESAKAAK-KGGATGFCVALLDEAIELREAGVQDPILILSVVDLAYVPLLIQYDLSVTVATQEWLE---A---A-LQQ-L---T-P----ESNTPLRVHLKVDTGMGRIGFL-TPE-E-T-KQAVRFV-Q--SH--KEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAV--L-E---ELPR---YV---HVSNSATALWHPD---VPGNMIRYGVAMYGLNPSGNKLAP--SYALKPALRLTSELIHVKRLAAGEGIGYGETYVTEAEEWIGTVPIGYADGWLRHLQG-F-T-VLVNGKRCEIVGRVCMDQCMIRL-AE---E-VPVGPVVTLVGKDGNEENTLQMVAEKLETIHYEVACTFSQRIPREY--------------------
14 PsiBlast_PDB 77.8236%-131 - C1 -4Y2W ALR1_CALS4 A:[7-378] -------RPTRVE-VYLDAITHNFREIKKIVGKNV--K--IMAVIKGDAYGHGASYVAKFLE-KEGVDYFGVATTEEALELREKGIKTPILIFGYTPPTQLRQIVKHDLTQTVYDIKYAK---E---L-EKE-S---L-K----QNKR-AKVHIKIDTGLGRIGYI-DFD-L-A-QKEILEM-A--NM--RGLILEGIYSHFAAASEDDRDYCKEQFDKFMNLISS--L-E---KKRL---KIPLKHIANAAAILNLNY---SHLDMVRPGIILFGAYPSKRVERK-V--ELRETLRFTTRVVHLKDVPAGFFIGYGKSFVTKRKSVIATIPVGYADGLDRRLSN-NYK-LLLKGKYVPIVGRVCMDQCMIDVTDV---EGVEIGDEVVIIGTQNNETVSVESMADKIETIPQEVFSRISRRVPRVYFYDG----------------
8 PsiBlast_PDB 77.4640%-127 - C1 -3OO2 ALR1_STAAC A:[5-385] -SDK-YYRSAYMN-VDLNAV---ASNFKVFSTLHP--NKTVMAVVKANAYGLGSVKVARHLM-ENGATFFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQHRVALTVPSKQWLK---E---A-IKN-ISGEQ-E----KK---LWLHIKLDTGMGRLGIK-DTK-T-Y-QEVIEII-Q--QY--EQLVFEGVFTHFACADEP-GDMTTEQYQRFKDMVNE----A---IKPE---YI---HCQNSAGSLLMDC---QFCNAIRPGISLYGYYPSEYVQQK-VKVHLKPSVQLIANVVQTKTLQAGESVSYG--YTATDPTTIALLPIGYADGYLRIMQG-S-F-VNVNGHQCEVIGRVCMDQTIVKV-PD---Q-VKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNLSRRLPRIY-HDGDQRFVTNELLK-----
31 PsiBlast_CBE 77.1036%-130 - C1 -4Y2W ALR1_CALS4 B:[7-378] -------RPTRVE-VYLDAITHNFREIKKIVGKNV--K--IMAVIKGDAYGHGASYVAKFLE-KEGVDYFGVATTEEALELREKGIKTPILIFGYTPPTQLRQIVKHDLTQTVYDIKYAK---E---L-EKE-S---L-K----QNKR-AKVHIKIDTGLGRIGYI-DFD-L-A-QKEILEM-A--NM--RGLILEGIYSHFAAASEDDRDYCKEQFDKFMNLISS--L-E---KKRL---KIPLKHIANAAAILNLNY---SHLDMVRPGIILFGAYPSKRVERK-V--ELRETLRFTTRVVHLKDVPAGFFIGYGKSFVTKRKSVIATIPVGYADGLDRRLSN-NYK-LLLKGKYVPIVGRVCMDQCMIDVTDV---EGVEIGDEVVIIGTQNNETVSVESMADKIETIPQEVFSRISRRVPRVYFYDG----------------
12 PsiBlast_PDB 77.0738%-127 - C1 -4LUY - ? A:[8-385] ---------TWAE-INLDNLRFNLNNIKNLLEEDI--K--ICGVIKADAYGHGAVEVAKLLE-KEKVDYLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINE---I-AKS-L---G-E----KA---C-VHV-IDSGMTRIGFQPNEE-S-V-QEIIE-L-N--KL--EYIDLEGMFTHFATADEVSKEYTYKQANNYKFMSDK--L-DEAGVKIA---IK---HVSNSAAIMDCPD---LRLNMVRAGIILYGHYPSDDVFKD--RLELRPAMKLKSKIGHIKQVEPGVGISYGLTYTTTGKETIATVPIGYADGFTRIQKN-P-K-VLIKGEVFDVVGRICMDQIMVRI-DKDI-D-IKVGDEVILFG-EGE--VTAERIAKDLGTINYEVLCMISRRVDRVYMENNELVQINSYLLK-----
54 HHSearch 75.1036%-129 - C1 -4Y2W ALR1_CALS4 A:[4-383] ----DGVRPTRVE-VYLDAITHNFREIKKIVGKNV--K--IMAVIKGDAYGHGASYVAK-FLEKEGVDYFGVATTEEALELREKGIKTPILIFGYTPPTQLRQIVKHDLTQTVYDIKYAK-------E-LEKESLK-Q-N----KR---AKVHIKIDTGLGRIGYI-D-F-D-LAQKEILEM-A--NM--RGLILEGIYSHFAAASEDDRDYCKEQFDKFMNLISSLEKKR---LKIP---LK---HIANAAAILNLNY---SHLDMVRPGIILFGAYPSKR--VE-RKVELRETLRFTTRVVHLKDVPAGFFIGYGKSFVTKRKSVIATIPVGYADGLDRRLSN-N-YKLLLKGKYVPIVGRVCMDQCMIDV-TDVE-G-VEIGDEVVIIGTQNNETVSVESMADKIETIPQEVFSRISRRVPRVYFYDGIKIGE-----------
60 HHSearch 74.6740%-136 - C1 -4A3Q ALR1_STAAM A:[2-375] -SDK-YYRSAYMN-VDLNAVASNFKVFSTLHP-NK--T--VMAVVKANAYGLGSVKVAR-HLMENGATFFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQHRVALTVPSKQWLK-------E-AIKNISGEQ-E----KK---LWLHIKLDTGMGRLGIK-D-T-NTY-QEVIEII-Q--QY--EQLVFEGVFTHF--------DMTTEQYQRFKDMVNE----A---IKPE---YI---HCQNSAGSLLMDC---QFCNAIRPGISLYGYYPSEYVQQK-VKVHLKPSVQLIANVVQTKT------------------TTIALLPIGYADGYLRIMQG-S-F-VNVNGHQCEVIGRVCMDQTIVKV-PD---Q-VKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNLSRRLPRIYHDGDQRF-------------
10 PsiBlast_PDB 71.4938%-125 - C1 -4LUT ? A:[8-384] ---------TWAE-INLDNLRFNLNNIKNLLEEDI--K--ICGVIKADAYGHGAVEVAKLLE-KEKVDYLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINE---I-AKS-L---G-E----KA---C-VHVKID-------FQPNEE-S-V-QEIIE-L-N--KL--EYIDLEGMFTHFATADEVSKEYTYKQANNYKFMSDK--L-DEAGVKIA---IK---HVSNSAAIMDCPD---LRLNMVRAGIILYGHYPSDDVFKD--RLELRPAMKLKSKIGHIKQVEPGVGISYGLKYTTTGKETIATVPIGYADGFTRIQKN-P-K-VLIKGEVFDVVGRICMDQIMVRI-DKDI-D-IKVGDEVILFG-EGE--VTAERIAKDLGTINYEVLCMISRRVDRVYMENNELVQINSYLL------
28 PsiBlast_CBE 70.6940%-127 - C1 -4A3Q ALR1_STAAM B:[2-382] -SDK-YYRSAYMN-VDLNAV---ASNFKVFSTLHP--NKTVMAVVKANAYGLGSVKVARHLM-ENGATFFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQHRVALTVPSKQWLK---E---A-IKN-ISGEQ-E----KK---LWLHIKLDTGMGRLGIK-DTN-T-Y-QEVIEII-Q--QY--EQLVFEGVFTHF----------TTEQYQRFKDMVNE----A---IKPE---YI---HCQNSAGSLLMDC---QFCNAIRPGISLYGYYPSEYVQQK-VKVHLKPSVQLIANVVQTKTL----------------PTTIALLPIGYADGYLRIMQG-S-F-VNVNGHQCEVIGRVCMDQTIVKV-PD---Q-VKAGDSVILIDNHRESPQSVEVVAEKQHTINYEVLCNLSRRLPRIY-HDGDQRFVTNELLK-----