@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu05840: (2016-06-09 )
MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQFYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAADFYNNVIDELIANGIEPFVNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYLYDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADVKAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNYYQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYGNIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTFMDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF

Atome Classification :

(66 SA) .........10........20........30........40........50........60---.----........70........80........90.-.-...-...100.......110.......120.......130-.--.-.....140-.......150.......160.......170.......180-------.........------------190----------.........200.......210.---..--.---.---..-220.......230..-..-...240.......250.-......260.......270.......280-......-.290.......300...--------..----..---310...--------....320.-...-.-----.-.-.330..---.-..-.---..--.340---.-........350.......360-.......370-..-.....380.......390.......400.......410.......420.......430.......440.......450.......460...----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQ----F----YDNYKEDIRLMKELGHNSFRMSISWSRLIPN-G-TGE-INDKAADFYNNVIDELIANGIEPFVNLFHFDMPMAL-Q--K-IGGWVNRE-TVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYL---------YDFHYPNKV------------D------------FKEAVQVGFHTMLSSARAIQAYR---EM--K---Q---DG-KIGIILNLTPSYPRS-SH-PADVKAGEIADAFFNRS-FLDPSVKGEFPKELVDILKHEGFMPDYNA-EDLDII-KKNTVDLLGVNYYQPRR--------VK----AK---EHLPNP--------DAPFL-PD-RYF-D-----P-Y-VM--PG---R-KM-N---PH--RG-----W-EIYEKGVYDILINLKENYGNI-ECFISENGMG-VE-GEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTFMDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF----
109 HHSearch 91.7750% -74 - C2 -5FOO ? A:[2-461] ------LAFPKEFWWGGATSGPQSEGRFAKQHR--NLFDYWYEEEPDLFYDYVGPDTASD----A----YHQIESDLTLLASLGHNSYRTSIQWTRLIDD-FEQAT-INPDGLAYYNRVIDACLANGIRPVINLHHFDLPIAL-Y--QAYGGWESKH-VVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYL---------MQFHYPAIV------------D------------GKKAVQVAYNLALATAKVIQAYR---RG--PAELS---DG-RIGTILNLTPAYPAS-QS-EADMAAAHFAELWNNDL-FMEAAVHGKFPEELVAVLKKDGVLWQSTP-EELALIAE-NRVDYLGLNFYHPKR--------VK----AP---DAIPV---------ISPSW-SP-EWYYD-----P-Y-LM--PG---HRMN-V---D---KG-----W-EIYPEAVYDIAIKMRDHYDNI-PWFLSENGVG-IS-GEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHT-QVRRPKASAYWFKKVATHNR-----
3 PsiBlast_PDB 89.8149% -68 - C2 -5FOO ? A:[4-460] --------FPKEFWWGGATSGPQSEGRFAK--QHRNLFDYWYEEEPDLFYDYVGPDTASD----A----YHQIESDLTLLASLGHNSYRTSIQWTRLIDDFE-QAT-INPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQ--A-YGGWESKH-VVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYL---------MQFHYPAIV------------D------------GKKAVQVAYNLALATAKVIQAYR---RG--PAELS---DG-RIGTILNLTPAYPAS-QS-EADMAAAHFAELWNNDL-FMEAAVHGKFPEELVAVLKKDGVLWQSTP-EELALI-AENRVDYLGLNFYHPKR--------VK----AP---DAIPVI--------SPSWS-PE-WYY-D-----P-Y-LM--PG---H-RM-N---VD--KG-----W-EIYPEAVYDIAIKMRDHYDNI-PWFLSENGVG-IS-GEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRP-KASAYWFKKVATHN------
25 PsiBlast_CBE 89.6749% -70 - C2 -5FOO ? B:[4-460] --------FPKEFWWGGATSGPQSEGRFAK--QHRNLFDYWYEEEPDLFYDYVGPDTASD----A----YHQIESDLTLLASLGHNSYRTSIQWTRLIDDFE-QAT-INPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQ--A-YGGWESKH-VVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYL---------MQFHYPAIV------------D------------GKKAVQVAYNLALATAKVIQAYR---RG--PAELS---DG-RIGTILNLTPAYPAS-QS-EADMAAAHFAELWNNDL-FMEAAVHGKFPEELVAVLKKDGVLWQSTP-EELALI-AENRVDYLGLNFYHPKR--------VK----AP---DAIPVI--------SPSWS-PE-WYY-D-----P-Y-LM--PG---H-RM-N---VD--KG-----W-EIYPEAVYDIAIKMRDHYDNI-PWFLSENGVG-IS-GEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRP-KASAYWFKKVATHN------
24 PsiBlast_CBE 89.1149% -68 - C2 -5FOO ? C:[4-460] --------FPKEFWWGGATSGPQSEGRFAK--QHRNLFDYWYEEEPDLFYDYVGPDTASD----A----YHQIESDLTLLASLGHNSYRTSIQWTRLIDDFE-QAT-INPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQ--A-YGGWESKH-VVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYL---------MQFHYPAIV------------D------------GKKAVQVAYNLALATAKVIQAYR---RG--PAELS---DG-RIGTILNLTPAYPAS-QS-EADMAAAHFAELWNNDL-FMEAAVHGKFPEELVAVLKKDGVLWQSTP-EELALI-AENRVDYLGLNFYHPKR--------VK----AP---DAIPVI--------SPSWS-PE-WYY-D-----P-Y-LM--PG---H-RM-N---VD--KG-----W-EIYPEAVYDIAIKMRDHYDNI-PWFLSENGVG-IS-GEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRP-KASAYWFKKVATHN------
21 PsiBlast_CBE 88.5549% -68 - C2 -5FOO ? F:[4-460] --------FPKEFWWGGATSGPQSEGRFAK--QHRNLFDYWYEEEPDLFYDYVGPDTASD----A----YHQIESDLTLLASLGHNSYRTSIQWTRLIDDFE-QAT-INPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQ--A-YGGWESKH-VVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYL---------MQFHYPAIV------------D------------GKKAVQVAYNLALATAKVIQAYR---RG--PAELS---DG-RIGTILNLTPAYPAS-QS-EADMAAAHFAELWNNDL-FMEAAVHGKFPEELVAVLKKDGVLWQSTP-EELALI-AENRVDYLGLNFYHPKR--------VK----AP---DAIPVI--------SPSWS-PE-WYY-D-----P-Y-LM--PG---H-RM-N---VD--KG-----W-EIYPEAVYDIAIKMRDHYDNI-PWFLSENGVG-IS-GEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRP-KASAYWFKKVATHN------
1 PsiBlast_PDB 87.5349% -71 - C2 -4B3K - ? A:[4-460] --------FPKEFWWGGATSGPQSEGRFAK--QHRNLFDYWYEEEPDLFYDYVGPDTASD----A----YHQIESDLTLLASLGHNSYRTSIQWTRLIDDFE-QAT-INPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQ--A-YGGWESKH-VVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYL---------MQFHYPAIV------------D------------GKKAVQVAYNLALATAKVIQAYR---RG--PAELS---DG-RIGTILNLTPAYPAS-QS-EADMAAAHFAELWNNDL-FMEAAVHGKFPEELVAVLKKDGVLWQSTP-EELALI-AENRVDYLGLNFYHPKR--------VK----AP---DAIPVI--------SPSWS-PE-WYY-D-----P-Y-LM--PG---R-RM-N---VD--KG-----W-EIYPEAVYDIAIKMRDHYDNI-PWFLSENGVG-IS-GEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRP-KASAYWFKKVATHN------
2 PsiBlast_PDB 86.8949% -68 - C2 -4B3L - ? A:[4-460] --------FPKEFWWGGATSGPQSEGRFAK--QHRNLFDYWYEEEPDLFYDYVGPDTASD----A----YHQIESDLTLLASLGHNSYRTSIQWTRLIDDFE-QAT-INPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQ--A-YGGWESKH-VVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYL---------MQFHYPAIV------------D------------GKKAVQVAYNLALATAKVIQAYR---RG--PAELS---DG-RIGTILNLTPAYPAS-QS-EADMAAAHFAELWNNDL-FMEAAVHGKFPEELVAVLKKDGVLWQSTP-EELALI-AENRVDYLGLNFYHPKR--------VK----AP---DAIPVI--------SPSWS-PE-WYY-D-----P-Y-LM--PG---R-RM-N---VD--KG-----W-EIYPEAVYDIAIKMRDHYDNI-PWFLSENGVG-IS-GEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRP-KASAYWFKKVATHN------
123 Fugue 86.1137% -89 * C2 *1E4I BGLA_PAEPO A:[1-447] -TIFQ---FPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAH-TP----GKVFNGDNGNVACDS----YHRYEEDIRLMKELGIRTYRFSVSWPRIFPN-G-DG-EVNQKGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQAL-QDA---GGWGNR-RTIQAFVQFAETMFREFHGKIQHWLTFNEPWCIAFLSNMLGVHAPGLT---------------------N------------LQTAIDVGHHLLVAHGLSVRRFR---ELGT--------SG-QIGIAPNVSWAVPYS--TSEEDKAACARTISLHSDW-FLQPIYQGSYPQFLVDWFAEQGATVPIQD-GDMDII-G-EPIDMIGINYYSMSV--------NR----FN---P-----------------E-AG-FLQ-S-----E-E-IN----------------MG--LPVTDIGW-PVESRGLYEVLHYLQ-KYGNI-DIYITENGAC-INDE----VVN-GKVQDDRRISYMQQHLVQVHRTIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHVDFRT-QVRTPKQSYYWYRNVVSNNWLETRR
27 PsiBlast_CBE 84.5840% -75 - C2 -3AHX ? C:[4-443] ------LRFPKDFIFGTATAAYQIEGAYKEDEKGESIWDR-FSHIPGNVAKMHNGDIACD----H----YHRYKEDVQLLKSLGIKSYRFSIAWPRIFPK-G-FGE-INQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKL-Q--D-IGGWANPQ-VADYYVDYANLLFREFGDRVKTWITHNEPWVASYLGYA---------LGVHAPGIK------------D------------MKMALLAAHNILLSHFKAVKAYR---EL--E---Q---DG-QIGITLNLSTCYSNS-AD-EEDIAAAHRSDGWNNRW-FLDAALKGTYPEDMIKIFSDTNIMPELPK-ELFTEV-FE-TSDFLGINYYTRQV--------VK-------------NN--------SEAFI-GA-----E-----S-V-AM--DN---P-KT------E--MG-----W-EIYPQGLYDLLTRIHRDYGNI-DLYITENGAA-FN-D---MVNRDGKVEDENRLDYLYTHFAAALSAIEAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHVNY-KTQERTIKKSAYWYKELIERS------
110 HHSearch 84.5435% -79 - C2 -4RE2 ? A:[33-498] ---LSRRAFPEGFVFGTAASAYQVEGMAKQGGRGPSIWDAFIEKPG-TIPNNATADVTVD----E----YHRYKEDVNIMKNMGFDAYRFSISWSRIFPN-G-TGM-VNQEGVDYYNRLIDYMVKKGIKPYANLYHYDLPLAL-H--EQYLGWLSPN-IVEAFADYADFCFQTFGDRVKDWFTFNEPRCVAALGYD---------NGFHAPGRC------------SGCDAGGNS----TTEPYLAAHHLILSHAAAVKRYR---EK--Y---QLYQKG-RIGILLDFVWYEPFS-DS-NADRAAAQRARDFHLGW-FLDPIIHGRYPYSMLEIVKD-RM-PTFSD-EESRMV-K-DSIDYVGINHYTSFY--------MK----DP---GPWNLT--------P-TSY-QD-DWH-VG----F-AYER--NGVPIG-AQ-A---N---SY-----WLYIVPWGINKAVTYVKETYGNP-TMILSENGMD-QP-GNV---SITQGVHDTVRIRYYRNYITELKKAIDDGAKVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYKT-LKRYPKDSAFWFKNMLS--------
31 PsiBlast_CBE 83.0239% -74 - C2 -4PTV ? B:[7-445] --------FPEDFIWGAATSSYQIEGAFNEDGKGESIWDR-FSHTPGKIENGDTGDIACD----H----YHLYREDIELMKEIGIRSYRFSTSWPRILPE-G-KGR-VNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQAL-Q--D-KGGWTNRD-TAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHA---------FGNHAPGTK------------D------------FKTALQVAHHLLLSHGMAVDIFR---EE--D---L---PG-EIGITLNLTPAYPAG-DS-EKDVKAASLLDDYINAW-FLSPVFKGSYPEELHHIYEQNLGAFTTQP-GDMDII-SRD-IDFLGINYYSRMV--------VR----HKPG-DNLFNA--------EVVKM-ED-R-----------------PS---T-EM----------G-----W-EIYPQGLYDILVRVNKEYTDK-PLYITENGAA-FD-DK---LTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIE--------
4 PsiBlast_PDB 83.0240% -76 - C2 -3AHX ? A:[2-443] ----EKLRFPKDFIFGTATAAYQIEGAYKEDEKGESIWDR-FSHIPGNVAKMHNGDIACD----H----YHRYKEDVQLLKSLGIKSYRFSIAWPRIFPK-G-FGE-INQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKL-Q--D-IGGWANPQ-VADYYVDYANLLFREFGDRVKTWITHNEPWVASYLGYA---------LGVHAPGIK------------D------------MKMALLAAHNILLSHFKAVKAYR---EL--E---Q---DG-QIGITLNLSTCYSNS-AD-EEDIAAAHRSDGWNNRW-FLDAALKGTYPEDMIKIFSDTNIMPELPK-ELFTEV-FE-TSDFLGINYYTRQV--------VK-------------NN--------SEAFI-GA-----E-----S-V-AM--DN---P-KT------E--MG-----W-EIYPQGLYDLLTRIHRDYGNI-DLYITENGAA-FN-D---MVNRDGKVEDENRLDYLYTHFAAALSAIEAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHVNY-KTQERTIKKSAYWYKELIERS------
28 PsiBlast_CBE 82.9640% -75 - C2 -3AHX ? B:[2-443] ----EKLRFPKDFIFGTATAAYQIEGAYKEDEKGESIWDR-FSHIPGNVAKMHNGDIACD----H----YHRYKEDVQLLKSLGIKSYRFSIAWPRIFPK-G-FGE-INQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKL-Q--D-IGGWANPQ-VADYYVDYANLLFREFGDRVKTWITHNEPWVASYLGYA---------LGVHAPGIK------------D------------MKMALLAAHNILLSHFKAVKAYR---EL--E---Q---DG-QIGITLNLSTCYSNS-AD-EEDIAAAHRSDGWNNRW-FLDAALKGTYPEDMIKIFSDTNIMPELPK-ELFTEV-FE-TSDFLGINYYTRQV--------VK-------------NN--------SEAFI-GA-----E-----S-V-AM--DN---P-KT------E--MG-----W-EIYPQGLYDLLTRIHRDYGNI-DLYITENGAA-FN-D---MVNRDGKVEDENRLDYLYTHFAAALSAIEAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHVNY-KTQERTIKKSAYWYKELIERS------
26 PsiBlast_CBE 82.6540% -73 - C2 -3AHX ? D:[2-443] ----EKLRFPKDFIFGTATAAYQIEGAYKEDEKGESIWDR-FSHIPGNVAKMHNGDIACD----H----YHRYKEDVQLLKSLGIKSYRFSIAWPRIFPK-G-FGE-INQKGIQFYRDLIDELIKNDIEPAITIYHWDLPQKL-Q--D-IGGWANPQ-VADYYVDYANLLFREFGDRVKTWITHNEPWVASYLGYA---------LGVHAPGIK------------D------------MKMALLAAHNILLSHFKAVKAYR---EL--E---Q---DG-QIGITLNLSTCYSNS-AD-EEDIAAAHRSDGWNNRW-FLDAALKGTYPEDMIKIFSDTNIMPELPK-ELFTEV-FE-TSDFLGINYYTRQV--------VK-------------NN--------SEAFI-GA-----E-----S-V-AM--DN---P-KT------E--MG-----W-EIYPQGLYDLLTRIHRDYGNI-DLYITENGAA-FN-D---MVNRDGKVEDENRLDYLYTHFAAALSAIEAGVPLKGYYIWSFMDNFEWAEGYEKRFGIVHVNY-KTQERTIKKSAYWYKELIERS------
29 PsiBlast_CBE 82.2639% -73 - C2 -4PTX ? B:[7-445] --------FPEDFIWGAATSSYQIEGAFNEDGKGESIWDR-FSHTPGKIENGDTGDIACD----H----YHLYREDIELMKEIGIRSYRFSTSWPRILPE-G-KGR-VNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQAL-Q--D-KGGWTNRD-TAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHA---------FGNHAPGTK------------D------------FKTALQVAHHLLLSHGMAVDIFR---EE--D---L---PG-EIGITLNLTPAYPAG-DS-EKDVKAASLLDDYINAW-FLSPVFKGSYPEELHHIYEQNLGAFTTQP-GDMDII-SRD-IDFLGINYYSRMV--------VR----HKPG-DNLFNA--------EVVKM-ED-R-----------------PS---T-EM----------G-----W-EIYPQGLYDILVRVNKEYTDK-PLYITENGAA-FD-DK---LTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIE--------
30 PsiBlast_CBE 82.0439% -72 - C2 -4PTW ? B:[7-445] --------FPEDFIWGAATSSYQIEGAFNEDGKGESIWDR-FSHTPGKIENGDTGDIACD----H----YHLYREDIELMKEIGIRSYRFSTSWPRILPE-G-KGR-VNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQAL-Q--D-KGGWTNRD-TAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHA---------FGNHAPGTK------------D------------FKTALQVAHHLLLSHGMAVDIFR---EE--D---L---PG-EIGITLNLTPAYPAG-DS-EKDVKAASLLDDYINAW-FLSPVFKGSYPEELHHIYEQNLGAFTTQP-GDMDII-SRD-IDFLGINYYSRMV--------VR----HKPG-DNLFNA--------EVVKM-ED-R-----------------PS---T-EM----------G-----W-EIYPQGLYDILVRVNKEYTDK-PLYITENGAA-FD-DK---LTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIE--------
5 PsiBlast_PDB 81.6839% -72 - C2 -4PTV ? A:[7-445] --------FPEDFIWGAATSSYQIEGAFNEDGKGESIWDR-FSHTPGKIENGDTGDIACD----H----YHLYREDIELMKEIGIRSYRFSTSWPRILPE-G-KGR-VNQKGLDFYKRLVDNLLKANIRPMITLYHWDLPQAL-Q--D-KGGWTNRD-TAKYFAEYARLMFEEFNGLVDLWVTHNEPWVVAFEGHA---------FGNHAPGTK------------D------------FKTALQVAHHLLLSHGMAVDIFR---EE--D---L---PG-EIGITLNLTPAYPAG-DS-EKDVKAASLLDDYINAW-FLSPVFKGSYPEELHHIYEQNLGAFTTQP-GDMDII-SRD-IDFLGINYYSRMV--------VR----HKPG-DNLFNA--------EVVKM-ED-R-----------------PS---T-EM----------G-----W-EIYPQGLYDILVRVNKEYTDK-PLYITENGAA-FD-DK---LTEEGKIHDEKRINYLGDHFKQAYKALKDGVPLRGYYVWSLMDNFEWAYGYSKRFGLIYVDYENGNRRFLKDSALWYREVIE--------