@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu06300: (2016-06-10 )
MTLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHSDSQHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDPHK

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70........80......-----..90........--------------100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.------......210........220.......230.......240.......250.......260.......270------.......280.....------..290.......300.......310.......-----320----.......330.......340.......350....-...360.......370...--....380.....---------------------------..390.......400.......410.......420.......430.......440.......450--.......--..460.......470.......480.......490.......500.......510.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IHHSDSQHEEPE--------------VKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYPSVQHERIQNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDPHK
22 PsiBlast_CBE 79.71100% -57 - C3 -4Q89 COTA_BACSU B:[2-511] -TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IH------EEPE--------------VKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYP-----RIQNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP--
10 PsiBlast_PDB 79.47100% -57 - C3 -4Q8B COTA_BACSU A:[2-511] -TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IH-------EPE--------------VKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYP----ERIQNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP--
21 PsiBlast_CBE 79.09100% -58 - C3 -4Q8B COTA_BACSU B:[2-512] -TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IHH-----EEPE--------------VKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYP-------QNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDPH-
3 PsiBlast_PDB 79.08100% -54 - C3 -1W6L COTA_BACSU A:[2-511] -TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IH------EEPE--------------VKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYPSVQHERIQNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP--
11 PsiBlast_PDB 79.06100% -53 - C3 -4YVN ? A:[2-511] -TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IHH-----EEPE--------------VKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYPSVQHERIQNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP--
14 PsiBlast_PDB 79.0599% -54 - C3 -4AKQ COTA_BACSU A:[2-511] -TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IHH-----EEPE--------------VKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYPSVQHERIQNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHDDYDMMRPMDITDP--
15 PsiBlast_PDB 79.0099% -57 - C3 -4A66 COTA_BACSU A:[2-511] -TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHT-----IHH-----EEPE--------------VKTVVHLHGGVTPDDSAGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINED------GSLFYPSA-PENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGD------FIQIGSDGGLLPRSV------KLNSFSLAPAERYDIIIDFTAYEGESIILANS-----AGC----GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLA-SYP----ERIQNIRTLKLA--GTQDEYGRPVLL---------------------------LNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYT----GPAVPPP--PSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP--