@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu06450: (2016-06-10 )
MNIVKNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKAEISGKGRLNNEISSLIFKHLHAKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPIIEFYYKDDALGDPLITEDHIWLLKAATPEQVETIKSITTIVNEELQSIFDDCHVRLIDFKLEFGLDAEGQVLLADEISPDTCRLWDKETNEKLDKDLFRRNLGSLTDAYEEIFNRLGGIHHV

Atome Classification :

(31 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180..---...---..190.......200.......210.......220.......230.......240
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNIVKNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKAEISGKGRLNNEISSLIFKHLHAKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPIIEFYYKDDALGDPLITEDHIWLLKAATPEQVETIKSITTIVNEELQSIFDDCHVRLIDFKLEFGL---DAE---GQVLLADEISPDTCRLWDKETNEKLDKDLFRRNLGSLTDAYEEIFNRLGGIHHV
36 HHSearch 90.3868% -66 - C3 -2YWV ? A:[4-239] --PTKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFGR---TAD---GAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGSLTDAYEVILQRLGGE---
21 PsiBlast_CBE 89.4268% -65 - C3 -2YWV ? B:[6-238] ----KQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFGR---TAD---GAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGSLTDAYEVILQRLGG----
1 PsiBlast_PDB 89.1368% -67 - C3 -2YWV ? A:[6-238] ----KQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFGR---TAD---GAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGSLTDAYEVILQRLGG----
33 HHSearch 82.5458% -66 - C3 -3NUA PUR7_CLOP1 A:[5-237] --VNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFGR---YN----GEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRLR-----
32 HHSearch 82.5247% -75 - C3 -2Z02 PUR7_METJA A:[7-241] -EILKKQPLYSGKAKSIYEID-DDKVLIEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DRE---GNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGL----
37 HHSearch 82.3353% -61 - C3 -4FE2 PUR7_STRPN A:[23-254] -----KQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKD---GKIILADEFSPDNCRLWDAD-GNHMDKDVFRRGLGELTDVYEIVWEKLQEL---
22 PsiBlast_CBE 82.2058% -66 - C3 -3NUA PUR7_CLOP1 B:[9-236] ------EMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG----RYN---GEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRL------
17 PsiBlast_PDB 82.0547% -71 - C3 -2YZL PUR7_METJA A:[8-240] --ILKKQPLYSGKAKSIYEIDDDKVL-IEFRDDITAG-GAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DRE---GNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLG-----
4 PsiBlast_PDB 81.9854% -61 - C3 -4FGR PUR7_STRPN A:[21-251] ---MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKD---GKIILADEFSPDNCRLWDADGNH-MDKDVFRRGLGELTDVYEIVWEKL------
6 PsiBlast_PDB 81.8048% -75 - C3 -3KRE PUR7_EHRCR A:[26-260] ------EKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEFGKLHNDEQ---SDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAI---
2 PsiBlast_PDB 81.7258% -66 - C3 -3NUA PUR7_CLOP1 A:[9-236] ------EMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG----RYN---GEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRL------
5 PsiBlast_PDB 81.6954% -62 - C3 -4NYE PUR7_STRPN A:[21-251] ---MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKD---GKIILADEFSPDNCRLWDADGNH-MDKDVFRRGLGELTDVYEIVWEKL------
3 PsiBlast_PDB 81.6254% -61 - C3 -4FE2 PUR7_STRPN A:[23-251] -----KQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKD---GKIILADEFSPDNCRLWDADGNH-MDKDVFRRGLGELTDVYEIVWEKL------
26 PsiBlast_CBE 81.5847% -72 - C3 -2Z02 PUR7_METJA B:[8-240] --ILKKQPLYSGKAKSIYEIDDDKVL-IEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DRE---GNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLG-----
34 HHSearch 81.2447% -73 - C3 -3KRE PUR7_EHRCR A:[26-262] ------EKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEFGK---LHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAIPN-
39 HHSearch 80.6649% -79 - C3 -3U55 PUR7_PYRHO A:[12-236] -------------AKKMIPID-DDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLG-ISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKN---GDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKP-
25 PsiBlast_CBE 80.5354% -60 - C3 -4FE2 PUR7_STRPN B:[21-251] ---MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKD---GKIILADEFSPDNCRLWDADGNH-MDKDVFRRGLGELTDVYEIVWEKL------
18 PsiBlast_PDB 80.3947% -72 - C3 -2Z02 PUR7_METJA A:[8-240] --ILKKQPLYSGKAKSIYEIDDDKVL-IEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGK---DRE---GNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLG-----
24 PsiBlast_CBE 80.0554% -64 - C3 -4FGR PUR7_STRPN B:[22-251] ----SKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKD---GKIILADEFSPDNCRLWDADGNH-MDKDVFRRGLGELTDVYEIVWEKL------
23 PsiBlast_CBE 80.0354% -62 - C3 -4NYE PUR7_STRPN B:[22-251] ----SKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKVWFAEIGLKLIDFKLEFGF---DKD---GKIILADEFSPDNCRLWDADGNH-MDKDVFRRGLGELTDVYEIVWEKL------
12 PsiBlast_PDB 79.1848% -85 - C3 -4O7T PUR7_PYRHO A:[12-233] -------------AKKMIPIDDDK-LIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVL-GISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKN---GDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITG----
20 PsiBlast_PDB 78.9749% -85 - C3 -4O81 PUR7_PYRHO A:[12-233] -------------AKKMIPIDD-DKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVL-GISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKN---GDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITG----
16 PsiBlast_PDB 78.8048% -83 - C3 -4O86 PUR7_PYRHO A:[12-233] -------------AKKMIPIDDDK-LIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVL-GISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK---DKN---GDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITG----
11 PsiBlast_PDB 78.6448% -96 - C3 -4O7S PUR7_PYRHO A:[15-233] ----------------MIPIDDDK-LIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVL-GISLDEIKKIEEIALKVNEILKD