@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu06520: (2016-06-10 )
MTIKRALISVSDKTNLVPFVKELTELGVEVISTGGTKKLLQENGVDVIGISEVTGFPEIMDGRLKTLHPNIHGGLLAVRGNEEHMAQINEHGIQPIDLVVVNLYPFKETISKEDVTYEEAIENIDIGGPGMLRAASKNHQDVTVIVDPADYSPVLNQIKEEGSVSLQKKRELAAKVFRHTAAYDALIADYLTNVVGEKEPEQFTVTFEKKQSLRYGENPHQEATFYQTALPVKGSIAQAEQLHGKELSYNNIKDADAAVQIVREFTEPAAVAVKHMNPCGVGTGKTIAEAFDRAFEADKTSIFGGIIALNREVDKATAEALHNIFLEIIIAPSFSQEALDVLTAKKNLRLLTLDVSAAVQKEKQLTSVQGGLLIQDLDMHGFDDAEISIPTKREPNEQEWEDLKLAWKVVKHVKSNAIVLAKDNMTVGVGAGQMNRVGSAKIAIEQAGEKAKGSALGSDAYFPMPDTVEEAAKAGVTAIIQPGGSIRDEDSIKKADEYGIAMVFTGIRHFKH

Atome Classification :

(23 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150......--.--160-........170.......180.......190...-..-----..200---.........210---.......220-....--...230.......240.......250.......260....----.----..270-.......280-..--------------------.-.---...--------------------290.......300.......310.......320.......330.......340.......350......-.-360-........370....---...380.---..---.-.--..390-..-.....400.......410.......420.......430......---.440.......-----------------------------------------------------------------450.......460.......470.......480.......490.......500.......510
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTIKRALISVSDKTNLVPFVKELTELGVEVISTGGTKKLLQENGVDVIGISEVTGFPEIMDGRLKTLHPNIHGGLLAVRGNEEHMAQINEHGIQPIDLVVVNLYPFKETISKEDVTYEEAIENIDIGGPGMLRAASKNHQDVTVIVDPADYSPVLNQI--K--EE--GSVSLQKKRELAAKVFRHTAAYDALIADYLTNVV-GE-----KEP-----EQFTVTFEKKQS---LRYGENPHQE-ATFY--QTALPVKGSIAQAEQLHGKELSYNNIKDADAAVQIVREFT----E----PAAVA-VKHMNPCGVG-TG--------------------K-T---IAE--------------------AFDRAFEADKTSIFGGIIALNREVDKATAEALHNIFLEIIIAPSFSQEALDVLTAKKNLRLLTLDVSAA-V-QK--EKQLTSVQGGLLIQD---LDMHGFD---DA---E-I--SIPTK-RE-PNEQEWEDLKLAWKVVKHVKSNAIVLAKDNMTVGVGAGQMNRVG---SAKIAIEQAGE-----------------------------------------------------------------KAKGSALGSDAYFPMPDTVEEAAKAGVTAIIQPGGSIRDEDSIKKADEYGIAMVFTGIRHFKH
2 PsiBlast_PDB 81.9943%-106 - C12 -4A1O PUR9_MYCTU A:[10-523] --IRRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFP---DGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL--R--A---GGFTLAERKRLASLAFQHIAEYDIAVASWMQQTL-AP-----EHPVAAFPQWFGRSWRRVAM---LRYGENPHQQ-AALYGDPTAWP---GLAQAEQLHGKDMSYNNFTDADAAWRAAFDHE----Q----TCVAI-IKHANPCGIAISS--------------------V-S---VAD--------------------AHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLARKKNIRVLV--AAEP-L-AG--GSELRPISGGLLIQQSDQLDAHGDN---PA---N-W--TLATG-SP-ADPATLTDLVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVD---AARLAVERGGE-----------------------------------------------------------------RVRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
22 PsiBlast_CBE 81.7543%-106 - C12 -3ZZM PUR9_MYCTU B:[10-523] --IRRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL--R--A---GGFTLAERKRLASLAFQHIAEYDIAVASWMQQTL-AP-----EHPVAAFPQWFGRSWRRVAM---LRYGENPHQQ-AALYGDPTAWP---GLAQAEQLHGKDMSYNNFTDADAAWRAAFDHE----Q----TCVAI-IKHANPCGIAISS--------------------V-S---VAD--------------------AHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLARKKNIRVLV--AAEP-L-AG--GSELRPISGGLLIQQSDQLDAHGDN---PA---N-W--TLATG-SP-ADPATLTDLVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVD---AARLAVERGGE-----------------------------------------------------------------RVRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
1 PsiBlast_PDB 81.5643%-101 - C12 -3ZZM PUR9_MYCTU A:[10-523] --IRRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL--R--A---GGFTLAERKRLASLAFQHIAEYDIAVASWMQQTL-AP-----EHPVAAFPQWFGRSWRRVAM---LRYGENPHQQ-AALYGDPTAWP---GLAQAEQLHGKDMSYNNFTDADAAWRAAFDHE----Q----TCVAI-IKHANPCGIAISS--------------------V-S---VAD--------------------AHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLARKKNIRVLV--AAEP-L-AG--GSELRPISGGLLIQQSDQLDAHGDN---PA---N-W--TLATG-SP-ADPATLTDLVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVD---AARLAVERGGE-----------------------------------------------------------------RVRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
21 PsiBlast_CBE 81.0243%-104 - C12 -4A1O PUR9_MYCTU B:[10-523] --IRRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTV-ESGASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL--R--A---GGFTLAERKRLASLAFQHIAEYDIAVASWMQQTL-AP-----EHPVAAFPQWFGRSWRRVAM---LRYGENPHQQ-AALYGDPTAWP---GLAQAEQLHGKDMSYNNFTDADAAWRAAFDHE----Q----TCVAI-IKHANPCGIAISS--------------------V-S---VAD--------------------AHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLARKKNIRVLV--AAEP-L-AG--GSELRPISGGLLIQQSDQLDAHGDN---PA---N-W--TLATG-SP-ADPATLTDLVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVD---AARLAVERGGE-----------------------------------------------------------------RVRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
40 HHSearch 79.4944% -97 * C12 *3ZZM PUR9_MYCTU A:[9-523] -PIRRALISVYDKTGLVDLAQGLSAAGVEIISTGSTAKTIADTGIPVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKSEHAAALEQLGIEAFELVVVNLYPFSQTVESG-ASVDDCVEQIDIGGPAMVRAAAKNHPSAAVVTDPLGYHGVLAAL--R--A---GGFTLAERKRLASLAFQHIAEYDIAVASWMQQTL-APEHPVAAFP-----QWFGRSWRRVAM---LRYGENPHQQ-AALY--GD-PTAWPGLAQAEQLHGKDMSYNNFTDADAAWRAAFDHE----Q----TCVAI-IKHANPCGIA-IS--------------------SVS---VAD--------------------AHRKAHECDPLSAYGGVIAANTEVSVEMAEYVSTIFTEVIVAPGYAPGALDVLARKKNIRVLVAAEPLA----G--GSELRPISGGLLIQQ---SDQLDAHGDNPA---N-W--TLATG-SP-ADPATLTDLVFAWRACRAVKSNAIVIAADGATVGVGMGQVNRVD---AARLAVERGGE-----------------------------------------------------------------RVRGAVAASDAFFPFPDGLETLAAAGVTAVVHPGGSVRDEEVTEAAAKAGVTLYLTGARHFAH
42 HHSearch 78.8339% -88 - C12 -1G8M PUR9_CHICK A:[5-593] --QQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARN-IPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEM--A--ASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEY-S-------------------KGVSQLP---LRYGMNPHQS-PAQL--YT-TRP---KLPLTVVNGS-PGFINLCDALNAWQLVKELKQALGI----PAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLHKTLT-P---LAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-YEPD--DNEIRTLYGLQLMQK---RNNAVID---RS---L-FK-NIVTK-NKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
41 HHSearch 71.1642% -97 - C12 -4EHI PUR9_CAMJE A:[23-534] -NAMRALLSVSDKEGIVEFGKELENLGFEILSTGGTFKLLKENGIKVIEVSDFT--------------------------------------ILGIDLVCVNLYPFKKTTIMS-DDFDEIIENIDIGGPAMIRSAAKNYKDVMVLCDPLDYEKVIETL--K--K---GQNDENFRLNLMIKAYEHTANYDAYIANYMNERF-NG-----GFG-----ASKFIVGQKVFD---TKYGENPHQK-GALY--EF-DAF--FSANFKALKG-EASFNNLTDINAALNLASSFDK---A----PAIAI-VKHGNPCGFA-IK--------------------E-N---LVQ--------------------SYIHALKCDSVSAYGGVVAINGTLDEALANKINEIYVEVIIAANVDEKALAVFEGKKRIKIFTQESPFLIRSFD--KYDFKHIDGGFVYQN---SDEVGEDE--LK---N-A--KLMSQ-RE-ASKEELKDLEIAMKIAAFTKSNNVVYVKNGAMVAIGMGMTSRID---AAKAAIAKAKEMGL--------------------------------------------------------------DLQGCVLASEAFFPFRDSIDEASKVGVKAIVEPGGSIRDDEVVKAADEYGMALYFTGVRHFLH
15 PsiBlast_PDB 71.1436% -94 - C12 -1G8M PUR9_CHICK A:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
36 PsiBlast_CBE 71.1136% -97 - C12 -2B1G PUR9_CHICK B:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
32 PsiBlast_CBE 70.6736%-102 - C12 -2IU0 PUR9_CHICK B:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 70.4736% -93 - C12 -2B1I PUR9_CHICK A:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
37 PsiBlast_CBE 70.2036% -97 - C12 -1THZ PUR9_CHICK B:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 70.1236% -96 - C12 -1OZ0 PUR9_CHICK A:[28-483] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
35 PsiBlast_CBE 70.0836% -97 - C12 -2B1G PUR9_CHICK C:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 69.8936% -98 - C12 -2B1G PUR9_CHICK A:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
31 PsiBlast_CBE 69.5336% -96 - C12 -2IU3 PUR9_CHICK B:[8-463] -----ALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAAS--KD--KDTSVETRRHLALKAFTHTAQYDAAISDY-----------------------FRKEYSKGVSQLPLRYGMNPHQSPAQLY--TTRPKLPLTVVNGSP------GFINLCDALNAWQLVKELK----QALGIPAAAS-FKHVSPAGAA-VGIPLSEEEAQVCMVHDLH---K-TLTPLAS--------------------AYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPN-Y-EPD-DNEIRTLYGLQLMQK---RNNAVID---RSLFKN-I--VTKNK-TL-P-ESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 69.4336% -95 - C12 -1PL0 PUR9_HUMAN B:[7-464] -----ALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILA-RNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEM--QSSES--KDTSLETRRQLALKAFTHTAQYDEAISDYFR-------------------KQYSKGVS-QMP---LRYGMNPHQTPAQLYTLQPKLPIT-------VLNGAP-GFINLCDALNAWQLVKELK----EALGIPAAAS-FKHVSPAGAA-VG--------------------I-P---LSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQS-Y-KP--DENEVRTLFGLHLSQ---KRNNGVV---DK---S-LFSNVVTKNKD-LPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIH---CTRLAGDKA----------------------------------------------------------------------------------------------------------------------------------