@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu06530: (2016-06-10 )
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQK

Atome Classification :

(20 SA) .........10.........20........30-....--.-...--40..--..--.-...50........60........70........80........90........100.......110.......120.......130.......-140.......150.......160.......170.......180.......190.......200.......210.......220.......230-.......-240.......-250........260.......270.....-..-280.......290.......300......---.----310----........--320.-.....-----...330--........340--.---....-...--350.-.--.--.-...----.-----.360......-.370.......380.......390.......400.......410.......420
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNVLIIGKGG-REHTLAWKAAQSSLVENVFAA-PGND--G-MAA--SAQL--VN--I-EESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAP-IVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYS-PVPQISE-ETVRHAVETI-V-KPAAKAMVQEGRSFTGVLYAGLMLTEN-GS-KVIEFNARFGDPETQVVLPRMESDLVQVL---L----DL-----LDDKEVDL--R--W-KDTAA-----VSVVL---ASEGYPESYA---K---GTPI-GSL--A--A-E--T--E-QVV----V-----FHAGTKAEGG-EFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQK
1 PsiBlast_PDB 93.46100% -90 - C1 -2XD4 PUR2_BACSU A:[1-422] MNVLIIGKGG-REHTLAWKAAQSSLVENVFAA-PGND--G-MAA--SAQL--VN--I-EESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAP-IVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYS-PVPQISE-ETVRHAVETI-V-KPAAKAMVQEGRSFTGVLYAGLMLTEN-GS-KVIEFNARFGDPETQVVLPRMESDLVQVL---L----DL-----LDDKEVDL--R--W-KDTAA-----VSVVL---ASEGYPESYA---K---GTPI-GSL--A--A-E--T--E-QVV----V-----FHAGTKAEGG-EFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQK
2 PsiBlast_PDB 91.9397% -93 - C1 -2XCL PUR2_BACSU A:[2-422] -NVLIIGKGG-REHTLAWKAAQSSLVENVFAA-PGND--G-MAA--SAQL--VN--I-EESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAP-IVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYS-PVPQISE-ETVRHAVETI-V-KPAAKAMVQEGRSFTGVLYAGLMLTEN-GS-KVIEFNARFGDPETQVVLPRMESDLVQVL---L----DL-----LDDKEVDL--R--W-KDTAA-----VSVVL---ASEGYPESYA---K---GTPI-GSL--A--A-E--T--E-QVV----V-----FHAGTKAEGG-EFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQK
32 HHSearch 89.8396% -93 - C1 -2XCL PUR2_BACSU A:[1-422] MNVLIIGKGG-REHTLAWKAAQSSLVENVFAA-PGND--G-MAA--SAQL--VN--I-EESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAP-IVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYS-PVPQISEETVRHAVE-TI-V-KPAAKAMVQEGRSFTGVLYAGLMLTEN-GS-KVIEFNARFGDPETQVVLPRMESDLVQVL---L----DL-----LDDKEVDL--R--W-KDTAA-----V-SVV---L-A-SEGYPE---SYAKGTPI-GSL--A--A-E--T--E-QVV----V-----FHAGTKAEGG-EFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQK
5 PsiBlast_PDB 82.4462%-110 - C1 -2YS6 ? A:[22-439] MNVLVIGRGG-REHAIAWKAAQSPLVGKLYVA-PGNP--G-IAD--VAEL--VH--I-DELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD----GKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDAALEAI-L-RPAAKALAAEGRPFLGVLYAGLMATAN-GP-KVIEFNARFGDPEAQVVLPRLKTDLVEAV---L----AV-----MDGKELEL--E--W-TDEAV-----LGVVL---AAKGYPGAYE---R---GAEI-RGL--D--R-I--S--P-DAL----L-----FHAGTKREGG-AWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE----
3 PsiBlast_PDB 82.3362%-112 - C1 -2YRW ? A:[22-439] MNVLVIGRGG-REHAIAWKAAQSPLVGKLYVA-PGNP--G-IAD--VAEL--VH--I-DELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD------GVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDAALEAI-L-RPAAKALAAEGRPFLGVLYAGLMATAN-GP-KVIEFNARFGDPEAQVVLPRLKTDLVEAV---L----AV-----MDGKELEL--E--W-TDEAV-----LGVVL---AAKGYPGAYE---R---GAEI-RGL--D--R-I--S--P-DAL----L-----FHAGTKREGG-AWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE----
4 PsiBlast_PDB 82.0462%-109 - C1 -2YRX ? A:[22-438] MNVLVIGRGG-REHAIAWKAAQSPLVGKLYVA-PGNP--G-IAD--VAEL--VH--I-DELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD----GKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDAALEAI-L-RPAAKALAAEGRPFLGVLYAGLMATAN-GP-KVIEFNARFGDPEAQVVLPRLKTDLVEAV---L----AV-----MDGKELEL--E--W-TDEAV-----LGVVL---AAKGYPGAYE---R---GAEI-RGL--D--R-I--S--P-DAL----L-----FHAGTKREGG-AWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI-----
33 HHSearch 81.6261%-110 - C1 -2YRX ? A:[22-438] MNVLVIGRGGREHAIAWK-AAQSPLVGKLYVA-PGNP--G-IAD--VAEL--VH--I-DELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAP-IVIKAD----GKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYS-PVPQISD-EMMDAALEAI-L-RPAAKALAAEGRPFLGVLYAGLMATAN-GP-KVIEFNARFGDPEAQVVLPRLKTDLVEAV---L----AV-----MDGKELEL--E--W-TDEAV-----LGVVL---AAKGYPGAYE---R---GAEI-RGL--D--R-I--S--P-DAL----L-----FHAGTKREGG-AWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI-----
21 PsiBlast_CBE 76.7452% -91 - C1 -2YW2 PUR2_AQUAE B:[1-420] MKVLVVGNGG-REHAIAWKVAQSPLVKELYVA-KGNA--G-IWE--IAKR--VD--I-SPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKRIREEI-V-ERVIKGLKEEGIYYRGFLYAGLMITKE-GP-KVLEFNVRLGDPEAQPILMRVKNDFLETL---L----NF-----YEGKDVHI--K--E-DERYA-----LDVVL---ASRGYPEKPE---T---GKII-HGLDYL--K-S--M--E-DVV----V-----FHAGTKKEGN-FTVTSGGRVLNVCAYGKTLKEAKERAYEAIRYVCFEGMHYRKDIGDKAFK----
7 PsiBlast_PDB 76.6352% -89 - C1 -2YW2 PUR2_AQUAE A:[1-420] MKVLVVGNGG-REHAIAWKVAQSPLVKELYVA-KGNA--G-IWE--IAKR--VD--I-SPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKRIREEI-V-ERVIKGLKEEGIYYRGFLYAGLMITKE-GP-KVLEFNVRLGDPEAQPILMRVKNDFLETL---L----NF-----YEGKDVHI--K--E-DERYA-----LDVVL---ASRGYPEKPE---T---GKII-HGLDYL--K-S--M--E-DVV----V-----FHAGTKKEGN-FTVTSGGRVLNVCAYGKTLKEAKERAYEAIRYVCFEGMHYRKDIGDKAFK----
10 PsiBlast_PDB 76.2951% -97 - C1 -3MJF PUR2_YERPE A:[5-427] -NILIIGNGG-REHALGWKAAQSPLADKIYVA-PGNA--G-TAL--EPTLENVD--I-AATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAP-IVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYS-PAPVVTD-DVHQRVMDQV-I-WPTVRGMAAEGNIYTGFLYAGLMISAD-GQPKVIEFNCRFGDPETQPIMLRMRSDLVELC---LAGTQGK-----LNEKTSD------W-DERPS-----LGVVL---AAGGYPADYR---Q---GDVI-HGL--PQ-Q-E--V--K-DGK----V-----FHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAI-----
8 PsiBlast_PDB 74.7252% -91 - C1 -2YYA - PUR2_AQUAE A:[1-420] MKVLVVGNGG-REHAIAWKVAQSPLVKELYVA-KGNA--G-IWE--IAKR--VD--I-SPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKRIREEI-V-ERVIKGLKEEGIYYRGFLYAGLMITKE-GP-KVLEFNVRLGDPEAQPILMRVKNDFLETL---L----NF-----YEGKDVHI--K--E-DERYA-----LDVVL---ASRGYPEKPE---T---GKII-HGLDYL--K-S--M--E-DVV----V-----FHAGTKKEGN-FTVTSGGRVLNVCAYGKTLKEAKERAYEAIRYVCFEGMHYRKDIGDKAFK----
12 PsiBlast_PDB 74.2348%-101 - C1 -2IP4 ? A:[2-412] -KVLVVGSGG-REHALLWKAAQSPRVKRLYAA-PGNA--G-MEA--LAEL--VP--W-N-GDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVP-VVVKDSGLAAGKGVTVAFDLHQAKQAVANILNRAEGGE----VVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVA-PYPM-DE-ATLRRVEEEI-L-GPLVRGLRAEGVVYRGVVYAGLMLTRE-GP-KVLEFNARFGDPEAQALLPLLENDLVELA---L----RV-----AEGRLAGT--RLSW-KEGAA-----ACVVL---AAPGYPESPR---K---GIPL--HV--P--E-P--P--E-GVL----V-----FHAGTRREGG-RLVSAGGRVLNVVGLGRDLKEALERAYAYIPQVGFPGAVYRRDIGRRAL-----
13 PsiBlast_PDB 74.0341%-102 - C1 -3LP8 ? A:[22-440] MNVLVIGSGG-REHSMLHHIRKSTLLNKLFIA-PGRE--G-MSG--LADI--ID--I-DINSTIEVIQVCKKEKIELVVIGPETPLMNGLSDALTEEGILVFGPSKAAARLESSKGFTKELCMRYGIPTAKYGYFVDTNSAYKFIDKHKLP-LVVKADGLAQGKGTVICHTHEEAYNAVDAMLVHHKFGEAGCAIIIEEFLEGKEISFFTLVDGSNPVILGVAQDYKTIGDNNKGPNTGGMGSYS-KPNIITQ-EMEHIIIQKI-I-YPTIKAMFNMNIQFRGLLFAGIIIKKN-EP-KLLEYNVRFGDPETQSILPRLNSDFLK-L---L----SLTAKGKLGNESVEL--S--K-K--AA-----LCVVV---ASRGYPGEYK---K---NSII-NGIENI--E-K--L--P-NVQ----L-----LHAGTRREGN-NWVSDSGRVINVVAQGENLASAKHQAYAALDLLDWPDGIYRYDIGSC-------
11 PsiBlast_PDB 73.9347%-101 - C1 -2QK4 PUR2_HUMAN A:[26-451] -RVLIIGSGG-REHTLAWKLAQSHHVKQVLVA-PGNA--G-TAC--SEKI--SNTAI-SISDHTALAQFCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGL---KGVIVAKSKEEACKAVQEIMQE-------ETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYC-PAPQVSN-DLLLKIKDTV-L-QRTVDGMQQEGTPYTGILYAGIMLTKN-GP-KVLEFNCRFGDPECQVILPLLKSDLYEVIQSTL----DG-----LLCTSLPV--W--L-ENHTA-----LTVVM---ASKGYPGDYT---K---GVEITGFP--E--A-Q--A--L-GLE----V-----FHAGTALKNG-KVVTHGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKDIGFRAIAFL--
36 HHSearch 72.1748%-103 - C1 -2IP4 ? A:[1-414] MKVLVVGSGG-REHALLWKAAQSPRVKRLYAA-PGNA--G-MEA--LA----EL--VPWNGDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVP-VVVKDSGLAAGKGVTVAFDLHQAKQAVANILNR----AEGGEVVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVA-PYPM-DE-ATLRRVEEEI-L-GPLVRGLRAEGVVYRGVVYAGLMLTRE-GP-KVLEFNARFGDPEAQALLPLLENDLVELA---L----RV-----AEGRLAGT--RLSW-KEGAA-----ACVVL---A---APGYPESPRK---GIPL--HV--P--E-P--P--E-GVL----VFHAGTRREGGRL------VSAGGRVLNVVGLGRDLKEALERAYAYIPQVGFPGAVYRRDIGRRALAR---
34 HHSearch 72.1749% -93 - C1 -2YW2 PUR2_AQUAE A:[1-421] MKVLVVGNGG-REHAIAWKVAQSPLVKELYVAKGNAG--I-WEI--AKR---VD--I-SPTDVEKLAEFAKNEGVDFTIVGPEAPLVEGIVDEFEKRGLKIFGPNKEAAKLEGSKAFAKTFMKKYGIPTARYEVFTDFEKAKEYVEKVGAP-IVVKADGLAAGKGAVVCETVEKAIETLDRFLNKKIFGKSSERVVIEEFLEGEEASYIVMINGDRYVPLPTSQDHKRLLDEDKGPNTGGMGAYS-PTPVINE-EVEKRIREEI-V-ERVIKGLKEEGIYYRGFLYAGLMITKE-GP-KVLEFNVRLGDPEAQPILMRVKNDFLETL---L----NF-----YEGKDVHI--K--E-DERYA-----LDVVLASRGYPEKPETGK---I---IHGL-DYL-----K-S--M--E-DVV----VFHAGTKKEGNFTV------TSGGRVLNVCAYGKTLKEAKERAYEAIRYVCFEGMHYRKDIGDKAFKY---
35 HHSearch 72.0440% -96 - C1 -3LP8 ? A:[22-440] MNVLVIGSGG-REHSMLHHIRKSTLLNKLFIA-PGRE--GMSGL--AD-I--ID--I-DINSTIEVIQVCKKEKIELVVIGPETPLMNGLSDALTEEGILVFGPSKAAARLESSKGFTKELCMRYGIPTAKYGYFVDTNSAYKFIDKHKLP-LVVKADGLAQGKGTVICHTHEEAYNAVDAMLVHHKFGEAGCAIIIEEFLEGKEISFFTLVDGSNPVILGVAQDYKTIGDNNKGPNTGGMGSYSKPNII-TQ-EMEHIIIQKI-I-YPTIKAMFNMNIQFRGLLFAGIIIKKN-EP-KLLEYNVRFGDPETQSILPRLNSDFLKLL---S----LT-----AKGKLGNESVE--L-SKKAA-----LCVVV---ASRGYPGEYK---K---NSII-NGI--ENIE-K--L--P-NVQ----L-----LHAGTRREGN-NWVSDSGRVINVVAQGENLASAKHQAYAALDLLDWPDGIYRYDIGSC-------
37 HHSearch 71.6046%-102 - C1 -2QK4 PUR2_HUMAN A:[25-448] ARVLIIGSGG-REHTLAWKLAQSHHVKQVLVA-PGNAGTA-CSE--KISN--TA--I-SISDHTALAQFCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGL---KGVIVAKSKEEACKAVQEIMQE-------ETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYC-PAPQVSN-DLLLKIK-DTVL-QRTVDGMQQEGTPYTGILYAGIMLTKN-GP-KVLEFNCRFGDPECQVILPLLKSDLYEVI---Q----ST-----LDGLLCTS--LPVWLENHTA-----LTVVM---ASKGYPGDYT---K---GVEI-TGF--P--E-AQAL--GLEVFHAGTA-----LKNGKVVT-------HGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKDIGFRAI-----
38 HHSearch 67.8649% -93 - C1 -3MJF PUR2_YERPE A:[4-428] MNILIIGNGG-REHALGWKAAQSPLADKIYVA-PGNA--G-TALEPTLEN--VD--I-AATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAP-IVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYS-PAPVVTD-DVHQRVMDQV-IWPTVRGMAAEGNI-YTGFLYAGLMISADGQP-KVIEFNCRFGDPETQPIMLRMRSDLVELC---L----AG-----TQGKLNEK--TSDW-DERPSLGVVLAAGGY---PADYRQGDV-----------I-HGL--P--QQE--VKDG-KVF----HAGTK-LNGNHEV------VTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIA----