@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu06620: (2016-06-10 )
MDKETAKQRAEELRRTINKYSYEYYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVGGAVLEAFQKVTHGTPMLSLGNAFNADDLRDFDRRVRQSVGDDVAYNVELKIDGLAVSLRYEDGYFVRGATRGDGTTGEDITENLKTIRNIPLKMNRELSIEVRGEAYMPKRSFEALNEERIKNEEEPFANPRNAAAGSLRQLDPKIAAKRNLDIFVYSIAELDEMGVETQSQGLDFLDELGFKTNQERKKCGSIEEVITLIDELQAKRADLPYEIDGIVIKVDSLDQQEELGFTAKSPRWAIAYKFPAEEVVTKLLDIELNVGRTGVITPTAILEPVKVAGTTVSRASLHNEDLIKEKDIRILDKVVVKKAGDIIPEVVNVLVDQRTGEEKEFSMPTECPECGSELVRIEGEVALRCINPECPAQIREGLIHFVSRNAMNIDGLGERVITQLFEENLVRNVADLYKLTKERVIQLERMGEKSTENLISSIQKSKENSLERLLFGLGIRFIGSKAAKTLAMHFESLENLKKASKEELLAVDEIGEKMADAVITYFHKEEMLELLNELQELGVNTLYKGPKKVKAEDSDSYFAGKTIVLTGKLEELSRNEAKAQIEALGGKLTGSVSKNTDLVIAGEAAGSKLTKAQELNIEVWNEEQLMGELKK

Atome Classification :

(36 SA) .........10........20........30........40........50........60.......-.70.........80........90........100.---.---...--..110.......120.......130.......140.......150.......---160----.---.---.-.-.....170.......180.......190.......200.......210.......220...---...---.230-.-.......--.240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420...-.-...430.......440.......450.......460.......470.......480.......490.......500.......510.......520.......530..--.....540.......550.......560.......570.......580.......590.......600.......610.......620.......630.......640.......650.......660......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDKETAKQRAEELRRTINKYSYEYYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVGGAV-LE-AFQKVTHGTPMLSLGNAFNADDLRDFDRRVRQS---V---GDD--VAYNVELKIDGLAVSLRYEDGYFVRGATRGDGTTGEDITENLKTIRNIPLKM---N------R---E---L-S-IEVRGEAYMPKRSFEALNEERIKNEEEPFANPRNAAAGSLRQLDPKIAAKRNLDIFVYSIA---ELD---EM---G-VETQSQG--LDFLDELGFKTNQERKKCGSIEEVITLIDELQAKRADLPYEIDGIVIKVDSLDQQEELGFTAKSPRWAIAYKFPAEEVVTKLLDIELNVGRTGVITPTAILEPVKVAGTTVSRASLHNEDLIKEKDIRILDKVVVKKAGDIIPEVVNVLVDQRTGEEKEFSMPTECPECGSELVRIEGEVALRCINP-E-CPAQIREGLIHFVSRNAMNIDGLGERVITQLFEENLVRNVADLYKLTKERVIQLERMGEKSTENLISSIQKSKENSLERLLFGLGIRFIGSKAAKTLAMHFESLENLK--KASKEELLAVDEIGEKMADAVITYFHKEEMLELLNELQELGVNTLYKGPKKVKAEDSDSYFAGKTIVLTGKLEELSRNEAKAQIEALGGKLTGSVSKNTDLVIAGEAAGSKLTKAQELNIEVWNEEQLMGELKK
1 PsiBlast_PDB 76.4249% -87 - C6 -2OWO DNLJ_ECOLI A:[2-586] ---ESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVGAAP-LA-AFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDR---L---KNNEKVTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKL---H------G---ENIPA-R-LEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVG---VLE---GG---E-LPDTHLGRLLQF-KKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGEAVARCTGG-LICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALE--AASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVH--WPAP-------------------------------------------------------------------------------------
2 PsiBlast_PDB 75.5648% -93 - C6 -4GLX DNLJ_ECOLI A:[3-582] ----SIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQR----P-LA-AFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDR-------------TWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKL---H------G---ENIPA-R-LEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVG---VLE---GG---E-LPDTHLGRLLQF-KKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGEAVARCTGG-LICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALE--AASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVH-------------------------------------------------------------------------------------------
56 HHSearch 75.2750% -84 - C6 -2OWO DNLJ_ECOLI A:[2-586] ---ESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVGAAP-LA-AFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDR---LKN-NEK--VTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKL---HGEN---I---P---A-R-LEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVG---VLE---GG---ELPDTHLGR--LLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGEAVARCTGGLI-CGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGT--LEALEAASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVHWPAP---------------------------------------------------------------------------------------
58 HHSearch 74.8848% -89 - C6 -4GLX DNLJ_ECOLI A:[3-583] ----SIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQR----P-LA-AFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDR-------------TWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKL---H------GENIP---A-R-LEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVG---VLE---GG---ELPDTHLGR--LLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEGEAVARCTGGLI-CGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGT--LEALEAASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVHW------------------------------------------------------------------------------------------
4 PsiBlast_PDB 74.5148% -72 - C6 -1V9P DNLJ_THEFI A:[1-580] MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGARP-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERA---L---GRKRPFLYTVEHKVDGLSVNLYYEEGVLVFGATRGDGEVGEEVTQNLLTIPTIPRRL---K------GV--P---D-R-LEVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGL--GLE---ES---G-LKSQYEL--LLWLKEKGFPVEHGYEKALGAEGVEEVYRRFLAQRHALPFEADGVVVKLDDLALWRELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGEERPIRWPETCPECGHRLVK-EGKVH-RCPNP-L-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLL--EASLEELLEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVS-------------------------------------------------------------------------------------------
22 PsiBlast_CBE 73.9948% -67 - C6 -1V9P DNLJ_THEFI B:[1-580] MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGARP-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERA---L---GRKRPFLYTVEHKVDGLSVNLYYEEGVLVFGATRGDGEVGEEVTQNLLTIPTIPRRL---K------GV--P---D-R-LEVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGL--GLE---ES---G-LKSQYEL--LLWLKEKGFPVEHGYEKALGAEGVEEVYRRFLAQRHALPFEADGVVVKLDDLALWRELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGEERPIRWPETCPECGHRLVK-EGKVH-RCPNP-L-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLL--EASLEELLEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVS-------------------------------------------------------------------------------------------
21 PsiBlast_CBE 72.3146% -62 - C6 -1DGS DNLJ_THEFI B:[1-581] MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGARP-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERE---A---EAP--SLYTVEHKVDGLSV-LYYEEGVWSTGS--GDGEVGEEVTQNLLTIPTIPRRL---K------G---V---P-DRLEVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGLGLGLE---ES---G-LKSQYEL--LLWLKEKGFPVEHCYEKALGAEGVEEVYRRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHRLVK-EGKVH-RCPNP-L-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLL--EASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSM------ESK---------------------------------------------------------------------------------
45 Fugue 71.6646% -63 - C6 -1DGS DNLJ_THEFI A:[1-581] MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGARP-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERE---A---EAP--SLYTVEHKVDGLSV-LYYEEGVWST--GSGDGEVGEEVTQNLLTIPTIPRRL---K------G---V---PDR-LEVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALG---LGLGLEES---G-LKSQYEL--LLWLKEKGFPVEHCYEKALGAEGVEEVYRRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHRL--VKEGKVHRCPNP-L-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLL--EASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSMESK---------------------------------------------------------------------------------------
3 PsiBlast_PDB 71.2246% -61 - C6 -1DGS DNLJ_THEFI A:[1-581] MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGARP-LEPTFRPVRHPTRMYSLDNAFTYEEVLAFEERLERE---A---EAP--SLYTVEHKVDGLSV-LYYEEGVWSTGS--GDGEVGEEVTQNLLTIPTIPRRL---K------G---V---P-DRLEVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALGLGLGLE---ES---G-LKSQYEL--LLWLKEKGFPVEHCYEKALGAEGVEEVYRRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHRLVK-EGKVH-RCPNP-L-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLL--EASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSM------ESK---------------------------------------------------------------------------------
55 HHSearch 69.5746% -58 - C6 -1DGS DNLJ_THEFI A:[1-581] MTREEARRRINELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPEFKSPDSPTEQVGARPLEP-TFRPVRHPTRMYSLDNAFTYEEVLAFEERLERE---A---EAP--SLYTVEHKVDGLSV-LYYEEGVW--STGSGDGEVGEEVTQNLLTIPTIPRRL---KG-----V---P---D-R-LEVRGEVYMPIEAFLRLNEELEERGEKVFKNPRNAAAGSLRQKDPRVTAKRGLRATFYALG---LGL---GLEESG-LKSQYEL--LLWLKEKGFPVEHCYEKALGAEGVEEVYRRGLAQRHALPFEADGVVLKLDDLTLWGELGYTARAPRFALAYKFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPIRWPEACPECGHRLVKE--GKVHRCPNP-L-CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGT--MDRLLEASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSMES-------K--------------------------------------------------------------------------------
26 PsiBlast_CBE 62.0761% 0 - C- -1TAE DNLJ_ENTFA B:[11-324] -----ATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKV-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GKP--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRL---T------E---P---I-S-VEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DFG---PM---K-AKTQFEA--LEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 62.0761% 0 - C- -1TAE DNLJ_ENTFA C:[11-324] -----ATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKV-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GKP--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRL---T------E---P---I-S-VEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DFG---PM---K-AKTQFEA--LEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 62.0761% 0 - C- -1TAE DNLJ_ENTFA D:[11-324] -----ATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKV-LS-GFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKA---I---GKP--VAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRL---T------E---P---I-S-VEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVA---DFG---PM---K-AKTQFEA--LEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------