@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu07230: (2016-06-11 )
MKHMLIAGGGIGGLSAAISLRKAGFSVTLCEAASENRKTGAGILQPQNALAVLKELGVFEDCCKHGFQTEWFKTFDEQGNLLFQVSESFLDDSLPGRNNILRKTLNDILMKHAEAVGVDIKWGKKVVAYEETAESVTALCEDGEKMQADILAGFDGIHSVVRDKMLQKETEKEHLGMGAWRFYIELPDYTFEDATFMYRSGDTQIGVVPLAQHAGYVFVLQPCTSDYWDEEDTRFDRVKEILSGFRGLDFVTKHMSKQHPVIFNKLEQVAVQEPWHKGRVIIGGDAAHAGAPTLAQGAAMAIEDAIVLAEELQNHADHETALQAYYKRRAPRALKVQNLSSEIVRRRLKGEPGAEELIGECYAVLREGY

Atome Classification :

(20 SA) -.........10........20....-.-...30........40..-......50........60........70........80........90........------100.......110.-...--.-..-120.......130.......140..----.....--.150.......160.....-----..170--------------..-......180..-----....-.190-.......200-.---.......210.------...-------....220.......------.230--.....---..240......-..---250--.........260.....-----..270.--.---....-.280.......290.......300.......310.......320.......330.......340...-.-...--350----........360.......----------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MKHMLIAGGGIGGLSAAISLRKAGF-S-VTLCEAASENRKTGAGI-LQPQNALAVLKELGVFEDCCKHGFQTEWFKTFDEQGNLLFQVSESFLDDSLPGRNN------ILRKTLNDILMKHA-EAV--G-VD-IKWGKKVVAYEETAESVTALC-EDG----EKMQA--DILAGFDGIHSVVRDKMLQ-----KETE---------------KE-HLGMGAWRFYI-----ELPD-YTFE-DATFMYRSG--D---TQIGVVPL-AQ------HAG-------YVFVL-QPCTSDYW------DEED--TRFDR---VKEI-LSGFRG-LD---F----VTKHMSKQHPVIFNKLE-----QVAVQE--P---WHKG-RVIIGGDAAHAGAPTLAQGAAMAIEDAIVLAEELQNHADHETALQAYYKRRAPRALKVQNLSSEIVR-R-RLK--GE-----PGAEELIGECYAVLREGY----------------------------------------------------------------
12 PsiBlast_PDB 94.9830% 0 - C- -3C96 ? A:[7-380] ----ILIAGAGIGGLSCALALHQAGI-GKVTLLESSSEIRPLGVGINIQPA-AVEALAELGLGPALAATAIPTHELRYIDQSGATVWSEPRGVEAGNAYPQYS------IHRGELQMILLAAVRERL--G-QQAVRTGLGVERIEERDGRVLIGA-RDGHGKPQALGA--DVLVGADGIHSAVRAHLHP-----DQRP---------------LS-HGGITMWRGVT-----EFD---RFL-DGKTMIVAN--DEHWSRLVAYPISAR------HAAEGKSLVNWVCMV-PSAAVGQL------DNEADWNRDGR---LEDV-LPFFAD-WDLGWF----DIRDLLTRNQLILQY-------PMVDRD--PLPHWGRG-RITLLGDAAHLMYPMGANGASQAILDGIELAAALARNADVAAALREYEEARRPTANKI----------------------------------------------------------------------------------------------------------
112 HHSearch 91.5628% 0 - C- -3C96 ? A:[4-390] -PIDILIAGAGIGGLSCALALHQAGIGK-VTLLESSSEIRPLGVGI-NIQPAAVEALAELGLGPALAATAIPTHELRYIDQSGATVWSEPRGVEAGNAYPQYS------IHRGELQMILLAAV-RERL-GQQA-VRTGLGVERIEERDGRVLIGA-RDGHGKPQALGA--DVLVGADGIHSAVRAHLHP------DQR---------------PLSHGGITMWRGVT-----EFDR-FL-D-GKTMIVANDEHW---SRLVAYPI-SARHAAEGKSL-------VNWVCMVPSAAVGQLDNEADWNRD--GRLED---VLPF-FADWDLGWF---D----IRDLLTRNQLILQYPMV-----DRDPLP--H---WGRG-RITLLGDAAHLMYPMGANGASQAILDGIELAAALARNADVAAALREYEEARRPTANKIILANREREK-E-----------------------------------------------------------------------------------------------
136 Fugue 76.6330% -91 - C1 -4H2Q ? A:[10-379] KTRRAEVAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWM---HNKSVSKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVAADPVGRLTL----QTG----EVLEA--DLIVGADGVGSKVRDSIGF-----K-QD---------------RW-VSKDGLIRLIVPRMKKELGH-GEWD-NTIDMWNFW--PRV-QRILYSPC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANR-SLSKGNM-----FTPAALEAARYDPLRRVYSWPQ------------------------------------------------------------
138 Fugue 76.6030% -87 - C1 -4JY3 ? A:[10-379] KTRRAEVAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWM---HNKSVSKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVAADPVGRLTL----QTG----EVLEA--DLIVGADGVGSKVRDSIGF-----K-QD---------------RW-VSKDGLIRLIVPRMKKELGH-GEWD-NTIDMWNFW--PRV-QRILYSPC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-RSL--SKGNMFTPAALEAAR--YDPLRRVYSWPQ------------------------------------------------------------
135 Fugue 76.5930% -92 - C1 -4GF7 ? A:[10-379] KTRRAEVAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWM---HNKSVSKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVAADPVGRLTL----QTG----EVLEA--DLIVGADGVGSKVRDSIGF-----K-QD---------------RW-VSKDGLIRLIVPRMKKELGH-GEWD-NTIDMWNFW--PRV-QRILYSPC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKLDS------WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-RSL--SKGNMFTPAALEAAR--YDPLRRVYSWPQ------------------------------------------------------------
137 Fugue 73.3426% -94 - C1 -3C96 ? A:[4-403] -PIDILIAGAGIGGLSCALALHQAGIGK-VTLLESSSEIRPLGVGI-NIQPAAVEALAELGLGPALAATAIPTHELRYIDQSGATVWSEPRGVEAGNAYPQYS------IHRGELQMILLAAV-RERLGQ-QA-VRTGLGVERIEERDGRVLIGA-RDGHGKPQALGA--DVLVGADGIHSAVRAHLHP-----DQRP---------------LS-HGGITMWRGVT-----EFDR-FLDG-KTMIVANDEH-W---SRLVAYPI-SA------RHAAEGKSLVNWVCM-VPSAAVGQ------LDNE--ADWNRDGRLEDV-LPFFAD-WD---LGWFDIRDLLTRNQLILQYPMV-----DRDPLP--H---WGRG-RITLLGDAAHLMYPMGANGASQAILDGIELAAALARNADVAAALREYEEARRPTANKIILANREREK-E-EWA--AA-----SRPERPRL--------------------------------------------------------------------------
13 PsiBlast_PDB 72.7030%-106 - C1 -2RGJ ? A:[7-361] ----ILIAGAGIGGLSCALALHQAGI-GKVTLLESSSEIRPLGVGINIQPA-AVEALAELGLGPALAATAIPTHELRYIDQSGATVWSEPRGVEAGNAYPQYS------IHRGELQMILLAAVRERL--G-QQAVRTGLGVERIEERDGRVLIGA-RDGHGKPQALGA--DVLVGADGIHSAVRAHLHP-----DQRP---------------LS-HGGITMWRGVT-----EF-D-RFLD-GKTMIVAND--EHW-SRLVAYPISAR------HAAEGKSLVNWVCMV-PSAAVGQL------DNEADWNRDGR---LEDV-LPFFAD-WDLGWF----DIRDLLTRNQLILQYPM-----VDRDPL--PH--WGRG-RITLLGDAAHLMYPMGANGASQAILDGIELAAALARNADVAAALREYEEARRPTANKI----------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 72.3929% -92 - C1 -4H2Q ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
9 PsiBlast_PDB 72.3229% -89 - C1 -4JY3 ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
6 PsiBlast_PDB 72.3029% -88 - C1 -4H2P ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
1 PsiBlast_PDB 72.2929% -91 - C1 -4H2N ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKFE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
5 PsiBlast_PDB 72.1729% -93 - C1 -4GF7 ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
8 PsiBlast_PDB 72.1229% -89 - C1 -4JY2 ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
3 PsiBlast_PDB 72.0829% -92 - C1 -3GMC ? A:[52-386] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
4 PsiBlast_PDB 71.9729% -91 - C1 -3ALJ ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKYE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------
2 PsiBlast_PDB 71.8129% -89 - C1 -4H2R ? A:[16-350] ------VAGGGFAGLTAAIALKQNGW-D-VRLHEKSSELRAFGAGI-YLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSV---SKETF--NGLPWRI-------MTRSHLHDALVNRA-RAL--G-VD-ISVNSEAVA----ADPVGRLTLQTG----EVLEA--DLIVGADGVGSKVRDSIGF-----KQDRWVSKDGLIRLIVPRMKK-ELGHGEWDNTI-----DMWN-FWPR-VQRILYS--------------PC-NE------NEL-------YLGLM-APAADPRG------SSVP--IDLEV---WVEM----FPF-LE---P----CLIEAAKLKTARYDKFE-----TTKL-D--S---WTRG-KVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAA-N-R---------------------------------------------------------------------------------------------