@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu07350: (2016-06-11 )
MFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKKWDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFPIRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHEETPICGGTLIAKIFENAGIPAGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIGQLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIYDKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGGFNGTIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLERGVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEKRSFPY

Atome Classification :

(24 SA) .........10-.........20........30.....--...40........50......---..60........70........80........90......---..100......--.--110...---....120...-....130.......140-..-.....150.......160.......170.......180.......-190.......200.......210-.........220.......230.......240..--.-.--...250.......260.......270.......280.......290.......300.......310.......-320....-....330.......340.......350..------..----..-----.360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFQYEELNKQ--FIGGKWQEGSSPNVLENKNPYTQKTF--TTFRKATADDVDEAYRAAALA---KKKWDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGG---TRLKAAFEIGL--V--KNIIKE---AATFPIRMEG-KILPSTIDGKENRLYRV-PA-GVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHEETPICGGTL-IAKIFENAGIPAGLLNVVVTD---IAEIGDSFVEHPVPRIISFTGSTKVGSYIGQLAM--K-H--FKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIYDKFLELYQAKVESLKVGDP-M-DPDTI-IGPLINSRQTDGLMKTVEQAIEEGAVPVK------LG----GF-----NGTIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLERGVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEKRSFPY
18 PsiBlast_PDB 87.0834% -84 - C3 -3I44 ? A:[23-495] ------LNKRKFYINGLWDDPSTPHDLYVIDPSTEEAC--AVISLGSTRDADKAINAAKKA---FQTWKTTSPHERLGFVEKILEIYEKRSSDMAKTISMEMGAPIDMALNAQTATGSSHI--RNFIKA---YKEFSFQ-------EALIEGNEQAILHY-DAIGVVGLITPWNWPMNQVTLKVIPALLAGCTMVLKPSEIAPLSA-ML-FAEILDEAALPSGVFNLINGD---GANVGSYLSAHPDLEMISFTGSTRAGKDISKNAS--N-T--LKRVCLELGGKGANIIFADADID-ALQRGVRHCFYNSGQSCNAPTRMLVEQAIYDKAIKTAKDIAEKTQVGPG-H-QTGNH-IGPVVSKEQYDKIQDLIQSGIDEGATLVTGGTGLPMG----ME-----RGYYVRPTVFADVKPHMRIFREEIFGPVLSLLPFNTEDEAVTLANDTEYGLTNYIQSQDRSKCRRIAAQVRSGMVEVNGHEL--PGGSYFGGVKFSGRAREGGLWGIKEFLDTKAIS----------
2 PsiBlast_PDB 86.7847% -74 - C3 -3R64 - ? A:[11-492] -----DATKH--LIGGQWVEGNSDRISTNINPYDDSVI--AESKQASIADVDAAYEAAKKA---QAEWAATPAAERSAIIYRAAELLEEHREEIVEWLIKESGS---TRSKANLEITL--A--GNITKE---SASFPGRVHG-RISPSNTPGKENRVYRV-AK-GVVGVISPWNFPLNLSIRSVAPALAVGNAVVIKPASDTPVTGGVI-PARIFEEAGVPAGVISTVAGA---GSEIGDHFVTHAVPKLISFTGSTPVGRRVGELAI--N-GGPMKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFLEKFVEAVKNIPTGDP-S-AEGTL-VGPVINDSQLSGLKEKIELAKKEGATVQV------EG----PI-----EGRLVHPHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGLSAAVWSKDIDRAAQFALQIDSGMVHIND--------------------RFNGDWAIEEFTTDRWIGIKRSAENLYF
1 PsiBlast_PDB 86.6447% -71 - C- -4DNG - ALDY_BACSU A:[1-478] -MSFETLNKS--FINGKWTGGESGRTEDILNPYDQSVI--TTASLATGKQLEDAFDIAQKA---QKEWAKSTTEDRKAVLQKARGYLHENRDDIIMMIARETGG---TIIKSTIELEQ--T--IAILDE---AMTYTGELGGVKEVPSDIEGKTNKIYRL-PL-GVISSISPFNFPMNLSMRSIAPAIALGNSVVHKPDIQTAISGGTI-IAKAFEHAGLPAGVLNVMLTD---VKEIGDGMLTNPIPRLISFTGSTAVGRHIGEIAG--R-A--FKRMALELGGNNPFAVLSDADVDRAVDAAIFGKFIHQ----MIINRIIVHQDVYDEFVEKFTARVKQLPYGDQ-T-DPKTV-VGPLINERQIEKALEIIEQAKTDGIELAV------EG----KR-----VGNVLTPYVFVGADNNSKIAQTELFAPIATIIKAGSDQEAIDMANDTEYGLSSAVFTSDLEKGEKFALQIDSGMTHVNDQ----------------------NPWVVEEFTVTKWISIQK-------
3 PsiBlast_PDB 86.5036% -74 - C3 -4JZ6 ? A:[17-500] ----HMKTKL--FINNAWIDSSDQQTFERKHPVSSEVM--TESANATVTDAIKAAQAAEEA---FKTWKDVGPSERRRLLLKVADVMESKTPKFIEVMAMEVGA---SALWAGFNVHA--S--ANVFRE---AASLATQIQG-ETIPTDKAETLSMTLRQ-PV-GPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPATHA-L-ITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKAA--Q-H--LKRCLLELGGKSPLIVLDDADINAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEFVARFVEKTERLSVGDPCL-TGDCI-IGPMVSPNSGERINGLFKDAIDKGAKVVC------GG----MA-----QGAVMPATILDHVKSDMRIYDEETFGPITVVIRCKGEAEAIRIANDSVYGLSSGVFGRDINRALRVGMSIEYGCVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTELKWLTIEPFEQQYPF
117 HHSearch 86.2448% -72 - C3 -3R64 - ? A:[10-487] ----IDATKH--LIGGQWVEGNSDRISTNINPYDDSVI--AESKQASIADVDAAYEAAKKA---QAEWAATPAAERSAIIYRAAELLEEHREEIVEWLIKESGS---TRSKANLEITL--A--GNITKE---SASFPGRVHG-RISPSNTPGKENRVYRV-AK-GVVGVISPWNFPLNLSIRSVAPALAVGNAVVIKPASDTPVTG-GVIPARIFEEAGVPAGVISTVAGA---GSEIGDHFVTHAVPKLISFTGSTPVGRRVGELAINGG-P--MKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFLEKFVEAVKNIPTGDP-S-AEGTL-VGPVINDSQLSGLKEKIELAKKEGATVQV------EG----PI-----EGRLVHPHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGLSAAVWSKDIDRAAQFALQIDSGMVHIND--------------------RFNGDWAIEEFTTDRWIGIKRSA-----
118 HHSearch 85.3736% -69 - C3 -4NMK ? A:[4-485] --LNIMKVAN--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-RKDEKVD-LGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
26 PsiBlast_CBE 85.0635% -70 - C3 -4NMK ? C:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
22 PsiBlast_CBE 84.9035% -70 - C3 -4NMK ? G:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
40 PsiBlast_CBE 84.8535% -68 - C3 -4H73 ? C:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
31 PsiBlast_CBE 84.8135% -70 - C3 -4NMJ ? E:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
29 PsiBlast_CBE 84.6835% -68 - C3 -4NMJ ? G:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
6 PsiBlast_PDB 84.4235% -70 - C3 -4NMK ? A:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
33 PsiBlast_CBE 84.3735% -71 - C3 -4NMJ ? C:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
24 PsiBlast_CBE 84.2635% -69 - C3 -4NMK ? E:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
27 PsiBlast_CBE 84.2135% -71 - C3 -4NMK ? B:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
4 PsiBlast_PDB 84.2135% -70 - C3 -4H73 ? A:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
5 PsiBlast_PDB 84.2035% -69 - C3 -4NMJ ? A:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
37 PsiBlast_CBE 83.9935% -70 - C3 -4H73 ? F:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
38 PsiBlast_CBE 83.9735% -68 - C3 -4H73 ? E:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
34 PsiBlast_CBE 83.8435% -71 - C3 -4NMJ ? B:[11-485] ---------N--YINGEFKEPSTGAFQVKTSPVDGSKI--AEVPRSGREDAREAIDSAFEA---LKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGG---TYRKVWGEVVF--T--ERLIQN---AAELARHYQG-RVLQSDSESTISVVFKR-SK-GVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTG-WL-IAQMVAKAGLPKGVFNLVIGP---GPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAA--G-T--LKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDP-R-KDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLI------GG----RS-----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTRRFP-
12 PsiBlast_PDB 81.8135% -76 - C3 -3B4W ? A:[7-476] -----EYDKL--FIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAAADVDAAVAAARAAFD---NGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPP-TIIETMHWMGS--MGAMNYFAG---AADKVTWTET-R----TGSYGQSIVSRE-PV-GVVGAIVAWNVPLFLAVNKIAPALLAGCTIVLKPAAETPLTANAL--AEVFAEVGLPEGVLSVVPGG---I-ETGQALTSNPDIDMFTFTGSSAVGREVGRRAA--E-M--LKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPP-S-DPAAQ-IGPLISEKQRTRVEGYIAKGIEEGARLVC------GG----GRPEGLDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINWYAF--DPGSPFGGYKNSGIGRENGPEGVEHFTQQK-------------
98 PsiBlast_CBE 81.3833% -63 - C3 -4WB9 AL1A1_HUMAN A:[19-500] -----QYTKI--FINNEWHDSVSGKKFPVFNPATEEEL--CQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDR--LLLATMESMNG---GKLYSNAYLND--L--AGCIKTLRYCAGWADKIQG-RTIP--IDGNFFTYTRHEPI-GVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTA-LH-VASLIKEAGFPPGVVNIVPGY---GPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAG--KSN--LKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNP-L-TPGVT-QGPQIDKEQYDKILDLIESGKKEGA-KLE------CGGGPWGN-----KGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVV-SAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKN---
93 PsiBlast_CBE 80.4333% -63 - C3 -4X4L AL1A1_HUMAN A:[19-500] -----QYTKI--FINNEWHDSVSGKKFPVFNPATEEEL--CQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDR--LLLATMESMNG---GKLYSNAYLSD--L--AGCIKTLRYCAGWADKIQG-RTIP--IDGNFFTYTRHEPI-GVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTA-LH-VASLIKEAGFPPGVVNIVPGY---GPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAG--KSN--LKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNP-L-TPGVT-QGPQIDKEQYDKILDLIESGKKEGA-KLE------CGGGPWGN-----KGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVV-SAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKN---