@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu07430: (2016-06-11 )
MTQTWPFLHNAQSFIQENWNASGFQKPTPVQEQAAQLIMDGKDVIAESPTGTGKTLAYALPVLERIKPEQKHPQAVILAPSRELVMQIFQVIQDWKAGSELRAASLIGGANVKKQVEKLKKHPHIIVGTPGRVFELIKAKKLKMHEVKTIVLDETDQLVLPEHRETMKQIIKTTLRDRQLLCFSATLKKETEDVLRELAQEPEVLKVQRSKAEAGKVKHQYLICDQRDKVKLLQKLSRLEGMQALVFVRDIGNLSVYAEKLAYHHVELGVLHSEAKKMERAKIIATFEDGEFPLLLATDIAARGLDIENLPYVIHADIPDEDGYVHRSGRTGRAGKEGNVLSLVTKLEESKLKKMAKKLGVELSEAVYAGGKLKTK

Atome Classification :

(51 SA) .........10.........20........30........--40--........50........60..-----....-..------------------70--------.---------.-..----.....80........90-.-...-....-100........110--.......-120.-.......130...-..-..140-........150.......----160.-.......170.----.----.---....180---------.......190.......200.......210........220..-.....-230---...-.-.-.--..240---.-.......250.......260.......----270.......280.......290.......300.......310.......-------320-..------......330.......340.......-350.......360.......370....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTQTWPFLHN-AQSFIQENWNASGFQKPTPVQEQAAQLIM--DG--KDVIAESPTGTGKTLAYALPVL-----ERIK-PE------------------Q---------K---------H-PQ----AVILAPSRELVMQIFQV-I-QDW-KAGS-E-LRAASLIGGANV--KKQVEKL-KK-H-PHIIVGTPGRVFE-LI-KAKK--LKMHEVKTIVLDETDQLV----LP-E-HRETMKQIIKT----T----L---RDRQLLC---------FSATLKKETEDVLRELAQEPEVLKVQRS-KAEAGKVKHQYLIC-DQRDK-V-K---LLQ-K-L-S--RLEG----M-QALVFVRDIGNLSVYAEKLAYHHVELG----VLHSEAKKMERAKIIATFEDGEFPLLLATDIAARGLDIENLPYVIHADIP-------D-E-DG------YVHRSGRTGRAGKEGNVLSLVTKLEE-SKLKKMAKKLGVELSEAVYAGGKLKTK
22 PsiBlast_CBE 82.0831%-126 - C4 -4CT4 DDX6_HUMAN D:[24-366] -----------------------GWEKPSPIQEESIPIAL--SG--RDILARAKNGTGKSGAYLIPLL-----ERLD-LK------------------K---------D---------N-IQ----AMVIVPTRELALQVSQICI-QVS-KHMG-G-AKVMATTGGTNL--RDDIMRL-DD-T-VHVVIATPGRILD-LI-KKGV--AKVDHVQMIVLDEADKLL----SQ-D-FVQIMEDIILT----L----P---KNRQILL---------YSATFPLSVQKFMNSHLQKPYEINLMEE-LTLKG-VTQYYAYV-TERQK-V-H---CLN-T-LFS--RLQI----N-QSIIFCNSSQRVELLAKKISQLGYSCF----YIHAKMRQEHRNRVFHDFRNGLCRNLVCTDL----IDIQAVNVVINFDFP-------KLA-ET------YLHRIGRSGRFGHLGLAINLITYDDR-FNLKSIEEQLGTEI-------------
1 PsiBlast_PDB 82.0431%-132 - C4 -4CT4 DDX6_HUMAN B:[24-366] -----------------------GWEKPSPIQEESIPIAL--SG--RDILARAKNGTGKSGAYLIPLL-----ERLD-LK------------------K---------D---------N-IQ----AMVIVPTRELALQVSQICI-QVS-KHMG-G-AKVMATTGGTNL--RDDIMRL-DD-T-VHVVIATPGRILD-LI-KKGV--AKVDHVQMIVLDEADKLL----SQ-D-FVQIMEDIILT----L----P---KNRQILL---------YSATFPLSVQKFMNSHLQKPYEINLMEE-LTLKG-VTQYYAYV-TERQK-V-H---CLN-T-LFS--RLQI----N-QSIIFCNSSQRVELLAKKISQLGYSCF----YIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFP-------KLA-ET------YLHRIGRSGRFGHLGLAINLITYDDR-FNLKSIEEQLGTEI-------------
9 PsiBlast_PDB 80.2230%-113 - C4 -2HYI IF4A3_HUMAN C:[55-402] ---------------------AYGFEKPSAIQQRAIKQII--KG--RDVIAQSQSGTGKTATFSISVL-----QCLD-IQ------------------V---------R---------E-TQ----ALILAPTRELAVQIQKG-L-LAL-GDYM-N-VQCHACIGGTNV--GEDIRKL-DY-G-QHVVAGTPGRVFD-MI-RRRS--LRTRAIKMLVLDEADEML----NK-G-FKEQIYDVYRY----L----P---PATQVVL---------ISATLPHEILEMTNKFMTDPIRILVKRD-ELTLEGIK-QFFVA-VEREE-W-KFDTLCD-L-Y-D--TLTI----T-QAVIFCNTKRKVDWLTEKMREANFTVS----SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP-------N-NREL------YIHRIGRSGRYGRKGVAINFVKNDDI-RILRDIEQYYSTQIDE-----------
12 PsiBlast_PDB 80.0130%-111 - C4 -2J0S IF4A3_HUMAN A:[54-401] ---------------------AYGFEKPSAIQQRAIKQII--KG--RDVIAQSQSGTGKTATFSISVL-----QCLD-IQ------------------V---------R---------E-TQ----ALILAPTRELAVQIQKG-L-LAL-GDYM-N-VQCHACIGGTNV--GEDIRKL-DY-G-QHVVAGTPGRVFD-MI-RRRS--LRTRAIKMLVLDEADEML----NK-G-FKEQIYDVYRY----L----P---PATQVVL---------ISATLPHEILEMTNKFMTDPIRILVKRD-ELTLEGIK-QFFVA-VEREE-W-KFDTLCD-L-Y-D--TLTI----T-QAVIFCNTKRKVDWLTEKMREANFTVS----SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP-------N-NREL------YIHRIGRSGRYGRKGVAINFVKNDDI-RILRDIEQYYSTQIDE-----------
10 PsiBlast_PDB 79.8530%-111 - C4 -3EX7 IF4A3_HUMAN C:[55-402] ---------------------AYGFEKPSAIQQRAIKQII--KG--RDVIAQSQSGTGKTATFSISVL-----QCLD-IQ------------------V---------R---------E-TQ----ALILAPTRELAVQIQKG-L-LAL-GDYM-N-VQCHACIGGTNV--GEDIRKL-DY-G-QHVVAGTPGRVFD-MI-RRRS--LRTRAIKMLVLDEADEML----NK-G-FKEQIYDVYRY----L----P---PATQVVL---------ISATLPHEILEMTNKFMTDPIRILVKRD-ELTLEGIK-QFFVA-VEREE-W-KFDTLCD-L-Y-D--TLTI----T-QAVIFCNTKRKVDWLTEKMREANFTVS----SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP-------N-NREL------YIHRIGRSGRYGRKGVAINFVKNDDI-RILRDIEQYYSTQIDE-----------
3 PsiBlast_PDB 79.7731%-136 - C4 -5ANR - DDX6_HUMAN B:[115-457] -----------------------GWEKPSPIQEESIPIAL--SG--RDILARAKNGTGKSGAYLIPLL-----ERLD-LK------------------K---------D---------N-IQ----AMVIVPTRELALQVSQICI-QVS-KHMG-G-AKVMATTGGTNL--RDDIMRL-DD-T-VHVVIATPGRILD-LI-KKGV--AKVDHVQMIVLDEADKLL----SQ-D-FVQIMEDIILT----L----P---KNRQILL---------YSATFPLSVQKFMNSHLQKPYEINLMEE-LTLKG-VTQYYAYV-TERQK-V-H---CLN-T-LFS--RLQI----N-QSIIFCNSSQRVELLAKKISQLGYSCF----YIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLF----DIQAVNVVINFDFP-------KLA-ET------YLHRIGRSG----LGLAINLITYDDR-FNLKSIEEQLGTEI-------------
8 PsiBlast_PDB 79.2930%-112 - C4 -2XB2 IF4A3_HUMAN A:[55-402] ---------------------AYGFEKPSAIQQRAIKQII--KG--RDVIAQSQSGTGKTATFSISVL-----QCLD-IQ------------------V---------R---------E-TQ----ALILAPTRELAVQIQKG-L-LAL-GDYM-N-VQCHACIGGTNV--GEDIRKL-DY-G-QHVVAGTPGRVFD-MI-RRRS--LRTRAIKMLVLDEADEML----NK-G-FKEQIYDVYRY----L----P---PATQVVL---------ISATLPHEILEMTNKFMTDPIRILVKRD-ELTLEGIK-QFFVA-VEREE-W-KFDTLCD-L-Y-D--TLTI----T-QAVIFCNTKRKVDWLTEKMREANFTVS----SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP-------N-NREL------YIHRIGRSGRYGRKGVAINFVKNDDI-RILRDIEQYYSTQIDE-----------
105 HHSearch 78.9029%-138 - C4 -5ANR - DDX6_HUMAN B:[96-462] ----NEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIAL--SG--RDILARAKNGTGKSGAYLIPLL-----ERLD-LK------------------K---------D---------N-IQ----AMVIVPTRELALQVSQI-C-IQV-SKHMGG-AKVMATTGGTNL--RDDIMRL-DD-T-VHVVIATPGRILD-LI-KKGV--AKVDHVQMIVLDEADKLL----SQ-D-FVQIMEDIILT----L----P---KNRQILL---------YSATFPLSVQKFMNSHLQKPYEINLMEE--LTLKGVTQYYAYV-TERQK-V-H---CLNTL-F-S--RLQI----N-QSIIFCNSSQRVELLAKKISQLGYSCF----YIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLF----DIQAVNVVINFDFPK------L-A-ET------YLHRIGRSG----LGLAINLITYDDR-FNLKSIEEQLGTEIKPIPS--------
21 PsiBlast_CBE 78.8631%-131 - C4 -4CT5 DDX6_HUMAN B:[24-366] -----------------------GWEKPSPIQEESIPIAL--SG--RDILARAKNGTGKSGAYLIPLL-----ERLD-LK------------------K---------D---------N-IQ----AMVIVPTRELALQVSQICI-QVS-KHMG-G-AKVMATTGGTNL--RDDIMRL-DD-T-VHVVIATPGRILD-LI-KKGV--AKVDHVQMIVLDEADKLL----SQ-D-FVQIMEDIILT----L----P---KNRQILL---------YSATFPLSVQKFMNSHLQKPYEINLMEE-LTLKG-VTQYYAYV-TERQK-V-H---CLN-T-LFS--RLQI----N-QSIIFCNSSQRVELLAKKISQLGYSCF----YIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFP-------KLA-ET------YLHRIGRSGRFGHLGLAINLITYDDR-FNLKSIEEQLGTEI-------------
11 PsiBlast_PDB 78.6730%-108 - C4 -2J0Q IF4A3_HUMAN A:[54-401] ---------------------AYGFEKPSAIQQRAIKQII--KG--RDVIAQSQSGTGKTATFSISVL-----QCLD-IQ------------------V---------R---------E-TQ----ALILAPTRELAVQIQKG-L-LAL-GDYM-N-VQCHACIGGTNV--GEDIRKL-DY-G-QHVVAGTPGRVFD-MI-RRRS--LRTRAIKMLVLDEADEML----NK-G-FKEQIYDVYRY----L----P---PATQVVL---------ISATLPHEILEMTNKFMTDPIRILVKRD-ELTLEGIK-QFFVA-VEREE-W-KFDTLCD-L-Y-D--TLTI----T-QAVIFCNTKRKVDWLTEKMREANFTVS----SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP-------N-NREL------YIHRIGRSGRYGRKGVAINFVKNDDI-RILRDIEQYYSTQIDE-----------
113 HHSearch 78.5929%-141 - C4 -1XTI DX39B_HUMAN A:[10-377] ------FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI--LG--MDVLCQAKSGMGKTAVFVLATL-----QQLE-PV------------------T---------G---------Q-VS----VLVMCHTRELAFQISKE-Y-ERF-SKYMPN-VKVAVFFGGLSI--KKDEEVLKKN-C-PHIVVGTPGRILA-LA-RNKS--LNLKHIKHFILDECDKML----EQLD-MRRDVQEIFRM----T----P---HEKQVMM---------FSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKL-KDNEKNR-K---LFD-L-L-D--VLEF----N-QVVIFVKSVQRCIALAQLLVEQNFPAI----AIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPE------D-S-DT------YLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISEL----------
2 PsiBlast_PDB 78.5831%-130 - C4 -4CT5 DDX6_HUMAN A:[24-366] -----------------------GWEKPSPIQEESIPIAL--SG--RDILARAKNGTGKSGAYLIPLL-----ERLD-LK------------------K---------D---------N-IQ----AMVIVPTRELALQVSQICI-QVS-KHMG-G-AKVMATTGGTNL--RDDIMRL-DD-T-VHVVIATPGRILD-LI-KKGV--AKVDHVQMIVLDEADKLL----SQ-D-FVQIMEDIILT----L----P---KNRQILL---------YSATFPLSVQKFMNSHLQKPYEINLMEE-LTLKG-VTQYYAYV-TERQK-V-H---CLN-T-LFS--RLQI----N-QSIIFCNSSQRVELLAKKISQLGYSCF----YIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFP-------KLA-ET------YLHRIGRSGRFGHLGLAINLITYDDR-FNLKSIEEQLGTEI-------------
107 HHSearch 78.1029%-126 - C4 -1S2M - DHH1_YEAST A:[46-409] ----NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAI--TG--RDILARAKNGTGKTAAFVIPTL-----EKVK-PK------------------L---------N---------K-IQ----ALIMVPTRELALQTSQV-V-RTL-GKHC-G-ISCMVTTGGTNL--RDDILRL-NE-T-VHILVGTPGRVLD-LA-SRKV--ADLSDCSLFIMDEADKML----SR-D-FKTIIEQILSF----L----P---PTHQSLL---------FSATFPLTVKEFMVKHLHKPYEINLMEE--LTLKGITQYYAFV-EERQK-L-H---CLN-TLF-S--KLQI----N-QAIIFCNSTNRVELLAKKITDLGYSCY----YSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPK------T-A-ET------YLHRIGRSGRFGHLGLAINLINWNDR-FNLYKIEQELGTEIAAI----------
6 PsiBlast_PDB 77.4730%-127 - C4 -1S2M - DHH1_YEAST A:[64-407] ----------------------AGFEKPSPIQEEAIPVAI--TG--RDILARAKNGTGKTAAFVIPTL-----EKVK-PK------------------L---------N---------K-IQ----ALIMVPTRELALQTSQV-V-RTL-GKHC-G-ISCMVTTGGTNL--RDDILRL-NE-T-VHILVGTPGRVLD-LA-SRKV--ADLSDCSLFIMDEADKML----SR-D-FKTIIEQILSF----L----P---PTHQSLL---------FSATFPLTVKEFMVKHLHKPYEINLMEE-LTLKG-ITQYYAFV-EERQK-L-H---CLN-T-LFS--KLQI----N-QAIIFCNSTNRVELLAKKITDLGYSCY----YSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPK------T-A-ET------YLHRIGRSGRFGHLGLAINLINWNDR-FNLYKIEQELGTEIA------------
121 HHSearch 76.7431%-128 - C4 -2I4I DDX3X_HUMAN A:[17-387] ------FSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIK--EK--RDLMACAQTGSGKTAAFLLPIL-----SQIY-SDGPGEALRAMKENGRYGRRK---------Q---------Y-PI----SLVLAPTRELAVQIYEE-A-RKF-SYRS-R-VRPCVVYGGADI--GQQIRDL-ER-G-CHLLVATPGRLVD-MM-ERGK--IGLDFCKYLVLDEADRML----DM-G-FEPQIRRIVEQ----DTMPPK---GVRHTMM---------FSATFPKEIQMLARDFLDEYIFLAVG-----TSENITQKVVWV-EESDK-R-S---FLL-D-L-LNATGKD----S-LTLVFVETKKGADSLEDFLYHEGYACT----SIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPS------D-I-EE------YVHRIGRTGR--NLGLATSFFNERNI-NI-------------------------
114 HHSearch 75.7530%-104 - C4 -2DB3 VASA1_DROME A:[58-408] ------FTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVIS--SG--RDLMACAQTGSGKTAAFLLPIL-----SKLL-ED------------------PHELEL----G---------R-PQ----VVIVSPTRELAIQIFNE-A-RKF-AFES-Y-LKIGIVYGGTSF--RHQNECI-TR-G-CHVVIATPGRLLD-FV-DRTF--ITFEDTRFVVLDEADRML----DM-G-FSEDMRRIMTH----VTM--R---PEHQTLM---------FSATFPEEIQRMAGEFLKNYVFVAIGIV-GGACSDVKQTIYEV-NKYAKRS-K---LIE-I---L--SEQA----D-GTIVFVETKRGADFLASFLSEKEFPTT----SIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPS------K-I-DD------YVHRIGRTGRVGNNGRATSFFDPEK-----------------------------
109 HHSearch 75.6530%-106 - C4 -4D25 ? A:[57-409] -----------LRKYVLDNVLKAGYRKPTPIQKNAIPIIM--SG--RDLMGCAQTGSGKTAAFLVPII-----NMLL-QD------------------PKDLISENGCA---------Q-PQ----VIIVSPTRELTLQIFNE-A-RKF-SYGS-V-LKVAVAYGGTAV--RHQGDNI-AR-G-CHILVATPGRLHD-FV-ERNR--VSFGSVRFVVLDQADCML----DM-G-FMPSIEKMMLHPTMVE----T---TKRQTLM---------FSATFPEDIQHLAGRFLNNYLFVAVGIV-GGASTDVEQIFIEV-TKYEK-RNS---LKQ-L-I-E--ENDG----K-RILVFVETKRNADFIAAMLSEQQLLTS----SIHGDRMQREREEALQNFKSGKHCILVATAVAARGLDIKNVDIVVNYDLPK------S-I-DE------YVHRIGRTGRVGNRGKAVSFYDSDQ-----------------------------
4 PsiBlast_PDB 75.3230%-125 - C4 -4BRU - DHH1_YEAST A:[64-407] ----------------------AGFEKPSPIQEEAIPVAI--TG--RDILARAKNGTGKTAAFVIPTL-----EKVK-PK------------------L---------N---------K-IQ----ALIMVPTRELALQTSQV-V-RTL-GKHC-G-ISCMVTTGGTNL--RDDILRL-NE-T-VHILVGTPGRVLD-LA-SRKV--ADLSDCSLFIMDEADKML----SR-D-FKTIIEQILSF----L----P---PTHQSLL---------FSATFPLTVDEFMDKHLHKPYEINLMEE-LTLKG-ITQYYAFV-EERQK-L-H---CLN-T-LFS--KLQI----N-QAIIFCNSTNRVELLAKKITDLGYSCY----YSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPK------T-A-ET------YLHRIGRSGRFGHLGLAINLINWNDR-FNLYKIEQELGTEIA------------
7 PsiBlast_PDB 75.1730%-118 - C4 -2HXY - IF4A3_HUMAN A:[55-402] ---------------------AYGFEKPSAIQQRAIKQII--KG--RDVIAQSQSGTGKTATFSISVL-----QCLD-IQ------------------V---------R---------E-TQ----ALILAPTRELAVQIQKG-L-LAL-GDYM-N-VQCHACIGGTNV--GEDIRKL-DY-G-QHVVAGTPGRVFD-MI-RRRS--LRTRAIKMLVLDEADEML----NK-G-FKEQIYDVYRY----L----P---PATQVVL---------ISATLPHEILEMTNKFMTDPIRILVKRD-ELTLEGIK-QFFVA-VEREE-W-KFDTLCD-L-Y-D--TLTI----T-QAVIFCNTKRKVDWLTEKMREANFTVS----SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLP-------N-NREL------YIHRIGRSGRYGRKGVAINFVKNDDI-RILRDIEQYYSTQIDE-----------
13 PsiBlast_PDB 74.8929%-120 - C4 -1HV8 H669_METJA A:[25-355] -----------------------GFEKPTDIQMKVIPLFLN-DE--YNIVAQARTGSGKTASFAIPLI-----ELVN--E------------------N---------N---------G-IE----AIILTPTRELAIQVADE-I-ESL-KGNK-N-LKIAKIYGGKAI--YPQIKAL-K--N-ANIVVGTPGRILD-HI-NRGT--LNLKNVKYFILDEADEML----NM-G-FIKDVEKILNA----C----N---KDKRILL---------FSATMPREILNLAKKYMGDYSFIKAKIN-----ANIEQSYVEV-NENER-F-E---ALC-R-L-L--KNKE----F-YGLVFCKTKRDTKELASMLRDIGFKAG----AIHGDLSQSQREKVIRLFKQKKIRILIATDVMSRGIDVNDLNCVINYHLPQ------N-P-ES------YMHRIGRTGRAGKKGKAISIINRREY-KKLRYIER-------------------
5 PsiBlast_PDB 74.6530%-121 - C4 -4BRW DHH1_YEAST A:[19-362] ----------------------AGFEKPSPIQEEAIPVAI--TG--RDILARAKNGTGKTAAFVIPTL-----EKVK-PK------------------L---------N---------K-IQ----ALIMVPTRELALQTSQV-V-RTL-GKHC-G-ISCMVTTGGTNL--RDDILRL-NE-T-VHILVGTPGRVLD-LA-SRKV--ADLSDCSLFIMDEADKML----SR-D-FKTIIEQILSF----L----P---PTHQSLL---------FSATFPLTVDEFMDKHLHKPYEINLMEE-LTLKG-ITQYYAFV-EERQK-L-H---CLN-T-LFS--KLQI----N-QAIIFCNSTNRVELLAKKITDLGYSCY----YSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPK------T-A-ET------YLHRIGRSGRFGHLGLAINLINWNDR-FNLYKIEQELGTEIA------------
30 PsiBlast_CBE 74.3132%-137 - C4 -3EWS DD19B_HUMAN A:[79-413] ---------------------AMGFNRPSKIQENALPLMLAEPP--QNLIAQSQSGTGKTAAFVLAML-----SQVE-PA------------------N---------K---------Y-PQ----CLCLSPTYELALQTGKV-IEQMG-KFYP-E-LKLAYAVRGNKL--ER---GQ-KI-S-EQIVIGTPGTVLD-WCSKLKF--IDPKKIKVFVLDEADVMI----AT-QGHQDQSIRIQRM----L----P---RNCQMLL---------FSATFEDSVWKFAQKVVPDPNVIKLKRE-EETLDTIKQYYVLC-SSRDE-K------FQ-A-L-C--NLYGAITIA-QAMIFCHTRKTASWLAAELSKEGHQVA----LLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPV------D-K-DGNPDNETYLHRIGR----GKRGLAVNMV---------------------------------
14 PsiBlast_PDB 74.2230%-107 - C4 -4D25 ? A:[56-404] ---------N-LRKYVLDNVLKAGYRKPTPIQKNAIPIIM--SG--RDLMGCAQTGSGKTAAFLVPII-----NMLL-QD------------------P---------KDLISENGCAQ-PQ----VIIVSPTRELTLQIFNE-A-RKF-SYGS-V-LKVAVAYGGTAV--RHQGDNI-AR-G-CHILVATPGRLHD-FV-ERNR--VSFGSVRFVVLDQADCMLDMGFMP-S-IEKMMLHPTMV----E----T---TKRQTLM---------FSATFPEDIQHLAGRFLNNYLFVAVGIV-GGASTDVEQIFIEV-TKYEK-R-N---SLK-Q-LIE--ENDG----K-RILVFVETKRNADFIAAMLSEQQLLTS----SIHGDRMQREREEALQNFKSGKHCILVATAVAARGLDIKNVDIVVNYDLP-------K-SIDE------YVHRIGRTGRVGNRGKAVSF----------------------------------
15 PsiBlast_PDB 73.6530%-106 - C4 -4D26 ? A:[56-404] ---------N-LRKYVLDNVLKAGYRKPTPIQKNAIPIIM--SG--RDLMGCAQTGSGKTAAFLVPII-----NMLL-QD------------------P---------KDLISENGCAQ-PQ----VIIVSPTRELTLQIFNE-A-RKF-SYGS-V-LKVAVAYGGTAV--RHQGDNI-AR-G-CHILVATPGRLHD-FV-ERNR--VSFGSVRFVVLDQADCMLDMGFMP-S-IEKMMLHPTMV----E----T---TKRQTLM---------FSATFPEDIQHLAGRFLNNYLFVAVGIV-GGASTDVEQIFIEV-TKYEK-R-N---SLK-Q-LIE--ENDG----K-RILVFVETKRNADFIAAMLSEQQLLTS----SIHGDRMQREREEALQNFKSGKHCILVATAVAARGLDIKNVDIVVNYDLP-------K-SIDE------YVHRIGRTGRVGNRGKAVSF----------------------------------
32 PsiBlast_CBE 73.6132%-127 - C4 -3FHT DD19B_HUMAN A:[42-376] ---------------------AMGFNRPSKIQENALPLMLAEPP--QNLIAQSQSGTGKTAAFVLAML-----SQVE-PA------------------N---------K---------Y-PQ----CLCLSPTYELALQTGKV-IEQMG-KFYP-E-LKLAYAVRGNKL--ER---GQ-KI-S-EQIVIGTPGTVLD-WCSKLKF--IDPKKIKVFVLDEADVMI----AT-QGHQDQSIRIQRM----L----P---RNCQMLL---------FSATFEDSVWKFAQKVVPDPNVIKLKRE-EETLDTIKQYYVLC-SSRDE-K------FQ-A-L-C--NLYGAITIA-QAMIFCHTRKTASWLAAELSKEGHQVA----LLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPV------D-K-DGNPDNETYLHRIGRTGRFGKRGLAVNMV---------------------------------
19 PsiBlast_PDB 72.9632%-134 - C4 -3RRM DBP5_YEAST A:[22-353] ---------------------AMKFQKPSKIQERALPLLL--HNPPRNMIAQSQSGTGKTAAFSLTML-----TRVN-PE------------------D---------A---------S-PQ----AICLAPSRELARQTLEV-V-QEM-GKFT-K-I-TSQLI----V--PDSFEKN-KQIN-AQVIVGTPGTVLD-LM-RRKL--MQLQKIKIFVLDEADNML-------D-QQGLGDQCIRV----K----RFLPKDTQLVL---------FSATFADAVRQYAKKIVPNANTLEL-----VNVDAIKQLYMDCKNEADK-F-D---VLT-E-L-Y--GVMT----IGSSIIFVATKKTANVLYGKLKSEGHEVS----ILHGDLQTQERDRLIDDFREGRSKVLITTN------DIPTVSMVVNYDLPTLANGQAD-P-AT------YIHRIGRTGRFGRKGVAISFV---------------------------------
20 PsiBlast_PDB 72.5932%-121 - C4 -3RRN DBP5_YEAST A:[22-353] ---------------------AMKFQKPSKIQERALPLLL--HNPPRNMIAQSQSGTGKTAAFSLTML-----TRVN-PE------------------D---------A---------S-PQ----AICLAPSRELARQTLEV-V-QEM-GKFT-K-I-TSQLI----V--PDSFEKN-KQIN-AQVIVGTPGTVLD-LM-RRKL--MQLQKIKIFVLDEADNML-------D-QQGLGDQCIRV----K----RFLPKDTQLVL---------FSATFADAVRQYAKKIVPNANTLELQ-------DAIKQLYMDCKNEADK-F-D---VLT-E-L-Y--GVMT----IGSSIIFVATKKTANVLYGKLKSEGHEVS----ILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQAD-P-AT------YIHRIGRTGRFGRKGVAISFV---------------------------------
31 PsiBlast_CBE 72.5432%-127 - C4 -3FHT DD19B_HUMAN B:[42-376] ---------------------AMGFNRPSKIQENALPLMLAEPP--QNLIAQSQSGTGKTAAFVLAML-----SQVE-PA------------------N---------K---------Y-PQ----CLCLSPTYELALQTGKV-IEQMG-KFYP-E-LKLAYAVRGN------------KI-S-EQIVIGTPGTVLD-WCSKLKF--IDPKKIKVFVLDEADVMI----AT-QGHQDQSIRIQRM----L----P---RNCQMLL---------FSATFEDSVWKFAQKVVPDPNVIKLKRE-EETLDTIKQYYVLC-SSRDE-K------FQ-A-L-C--NLYGAITIA-QAMIFCHTRKTASWLAAELSKEGHQVA----LLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPV------D-K-DGNPDNETYLHRIGRTGRFGKRGLAVNMV---------------------------------
29 PsiBlast_CBE 72.2032%-124 - C4 -3G0H DD19B_HUMAN A:[58-392] ---------------------AMGFNRPSKIQENALPLMLAEPP--QNLIAQSQSGTGKTAAFVLAML-----SQVE-PA------------------N---------K---------Y-PQ----CLCLSPTYELALQTGKV-IEQMG-KFYP-E-LKLAYAVRGNKL--ER---GQ-KI-S-EQIVIGTPGTVLD-WCSKLKF--IDPKKIKVFVLDEADVMI----AT-QGHQDQSIRIQRM----L----P---RNCQMLL---------FSATFEDSVWKFAQKVVPDPNVIKLKRE-EETLDTIKQYYVLC-SSRDE-K------FQ-A-L-C--NLYGAITIA-QAMIFCHTRKTASWLAAELSKEGHQVA----LLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPV------D-K-DGNPDNETYLHRIGRTGRFGKRGLAVNMV---------------------------------
16 PsiBlast_PDB 71.4333%-110 - C4 -5ELX ? A:[19-350] ---------------------AMKFQKPSKIQERALPLLL--HNPPRNMIAQSQSGTGKTAAFSLTML-----TRVN-PE------------------D---------A---------S-PQ----AICLAPSRELARQTLEV-V-QEM-GKFT-K-I-TSQLI----V--PDSFEKN-KQIN-AQVIVGTPGTVLD-LM-RRKL--MQLQKIKIFVLDEADNML-------D-QQGLGDQCIRV----K----RFLPKDTQLVL---------FSATFADAVRQYAKKIVPNANTLELQTN-EVNVDAIKQLYMDCKNEADK-F-D---VLT-E-L-Y--GLMT----IGSSIIFVATKKTANVLYGKLKSEGHEVS----ILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQAD-P-AT------YIHRIGRTGRFGRKGVAISFV---------------------------------