@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu09290: (2016-06-14 )
METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPHPGWVEHNANEIWGSVLAVIASVISESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTSGICEELREKGYNDKFREKTGLLIDPYFSGTKVKWILDNVEGAREKAEKGELLFGTIDTWLIWKMSGGKAHVTDYSNASRTLMFNIYDLKWDDELLDILGVPKSMLPEVKPSSHVYAETVDYHFFGKNIPIAGAAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGKVNYALEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDSDVRGSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNISLKTLRVDGGAVKNNFLMQFQGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIANQWNLDKRFEPELEEEKRNELYKGWQKAVKAAMAFK

Atome Classification :

(43 SA) .........10........20........30........40........50........60...--.....70........80........90........100.......110.......120.......130.......140.......150.......160.......170....---...180.......190.......200.......210........220.......230..-.....240.......250.......260.......270.......280.......290.--.-.....300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400........410.......420.......430.......440.......450.......460.......470.......480.......490....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPHPGWVEHNANEIWGSVLAVIASVIS--ESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTSGICEELREKGYNDKFREKTGLLIDPYFSGTKVKWILDNVEGAREKAEKGELLFGTIDTWLIWKMSGGK---AHVTDYSNASRTLMFNIYDLKWDDELLDILGVPK-SMLPEVKPSSHVYAETVDYHFFGK-NIPIAGAAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGI--D-GKVNYALEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDSDVRGSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNIS-LKTLRVDGGAVKNNFLMQFQGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIANQWNLDKRFEPELEEEKRNELYKGWQKAVKAAMAFK
89 HHSearch 89.2274% -71 - C3 -3G25 GLPK_STAAC A:[4-499] MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMTEVIN--ENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYEQTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKA---AHITDYSNASRTLMFNIHDLEWDDELLELLTVPK-NMLPEVKASSEVYGKTIDYHFYGQ-EVPIAGVAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGI--D-GKVNYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEARGAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGID-VQSLRVDGGAVKNNFIMQFQADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREKLYRGWKKAVEATQVFK
1 PsiBlast_PDB 88.8072% -71 - C3 -3G25 GLPK_STAAC A:[5-499] -EKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMTEVIN--ENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYEQTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKA---AHITDYSNASRTLMFNIHDLEWDDELLELLTVPK-NMLPEVKASSEVYGKTIDYHFYGQ-EVPIAGVAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGI--D-GKVNYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEARGAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGID-VQSLRVDGGAVKNNFIMQFQADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREKLYRGWKKAVEATQVFK
2 PsiBlast_PDB 88.6772% -70 - C3 -3GE1 GLPK_STAAC A:[5-499] -EKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMTEVIN--ENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYEQTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKA---AHITDYSNASRTLMFNIHDLEWDDELLELLTVPK-NMLPEVKASSEVYGKTIDYHFYGQ-EVPIAGVAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGI--D-GKVNYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEARGAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGID-VQSLRVDGGAVKNNFIMQFQADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREKLYRGWKKAVEATQVFK
29 PsiBlast_CBE 87.1462% -82 - C3 -3EZW GLPK_ECOLI H:[5-497] ---YIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLA--KADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGR---VHVTDYTNASRTMLFNIHTLDWDDKMLEVLDIPR-EMLPEVRRSSEVYGQTNI-------RIPISGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGP--T-GEVNYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR-LHALRVDGGAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERNYRYAGWKKAVKRAMAWE
44 PsiBlast_CBE 86.3963% -68 - C3 -3H3N GLPK_ENTCA O:[4-498] -KNYVMAIDQGTTSSRAIIFDRNGKKIGSSQKEFPQYFPKSGWVEHNANEIWNSVQSVIAGAFI--ESGIRPEAIAGIGITNQRETTVVWDKTTGQPIANAIVWQSRQSSPIADQLKVDGHTEMIHEKTGLVIDAYFSATKVRWLLDNIEGAQEKADNGELLFGTIDSWLVWKLTDGQ---VHVTDYSNASRTMLYNIHKLEWDQEILDLLNIPS-SMLPEVKSNSEVYGHTRSYRFYGS-EVPIAGMAGDQQAALFGQMAFEKGMIKNTYGTGAFIVMNTGEEPQLSDNDLLTTIGYGI--N-GKVYYALEGSIFVAGSAIQWLRDGLRMIETSPQSEELAAKAKGDNEVYVVPAFTGLGAPYWDSEARGAVFGLTRGTTKEDFVRATLQAVAYQSKDVIDTMKKDSGID-IPLLKVDGGAAKNDLLMQFQADILDIDVQRAANLETTALGAAYLAGLAVGFWKDLDELKSMAEEGQMFTPEMPAEERDNLYEGWKQAVAATQTFK
14 PsiBlast_PDB 86.3963% -68 - C3 -3FLC GLPK_ENTCA O:[16-510] -KNYVMAIDQGTTSSRAIIFDRNGKKIGSSQKEFPQYFPKSGWVEHNANEIWNSVQSVIAGAFI--ESGIRPEAIAGIGITNQRETTVVWDKTTGQPIANAIVWQSRQSSPIADQLKVDGHTEMIHEKTGLVIDAYFSATKVRWLLDNIEGAQEKADNGELLFGTIDSWLVWKLTDGQ---VHVTDYSNASRTMLYNIHKLEWDQEILDLLNIPS-SMLPEVKSNSEVYGHTRSYRFYGS-EVPIAGMAGDQQAALFGQMAFEKGMIKNTYGTGAFIVMNTGEEPQL-DNDLLTTIGYGI--N-GKVYYALEGSIFVAGSAIQWLRDGLRMIETSPQSEELAAKAKGDNEVYVVPAFTGLGA-YWDSEARGAVFGLTRGTTKEDFVRATLQAVAYQSKDVIDTMKKDSGID-IPLLKVDGGAAKNDLLMQFQADILDIDVQRAANLETTALGAAYLAGLAVGFWKDLDELKSMAEEGQMFTPEMPAEERDNLYEGWKQAVAATQTFK
30 PsiBlast_CBE 86.3362% -78 - C3 -3EZW GLPK_ECOLI G:[5-497] ---YIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLA--KADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGR---VHVTDYTNASRTMLFNIHTLDWDDKMLEVLDIPR-EMLPEVRRSSEVYGQTNIDGKGGT-RIPISGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGP--T-GEVNYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR-LHALRVDGGAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERNYRYAGWKKAVKRAMAWE
38 PsiBlast_CBE 86.1963% -69 - C3 -3H45 GLPK_ENTCA O:[4-498] -KNYVMAIDQGTTSSRAIIFDRNGKKIGSSQKEFPQYFPKSGWVEHNANEIWNSVQSVIAGAFI--ESGIRPEAIAGIGITNQRETTVVWDKTTGQPIANAIVWQSRQSSPIADQLKVDGHTEMIHEKTGLVIDAYFSATKVRWLLDNIEGAQEKADNGELLFGTIDSWLVWKLTDGQ---VHVTDYSNASRTMLYNIHKLEWDQEILDLLNIPS-SMLPEVKSNSEVYGHTRSYEFYGS-EVPIAGMAGDQQAALFGQMAFEKGMIKNTYGTGAFIVMNTGEEPQLSDNDLLTTIGYGI--N-GKVYYALEGSIFVAGSAIQWLRDGLRMIETSPQSEELAAKAKGDNEVYVVPAFTGLGAPYWDSEARGAVFGLTRGTTKEDFVRATLQAVAYQSKDVIDTMKKDSGID-IPLLKVDGGAAKNDLLMQFQADILDIDVQRAANLETTALGAAYLAGLAVGFWKDLDELKSMAEEGQMFTPEMPAEERDNLYEGWKQAVAATQTFK
37 PsiBlast_CBE 86.1563% -68 - C3 -3H46 GLPK_ENTCA O:[4-498] -KNYVMAIDQGTTSSRAIIFDRNGKKIGSSQKEFPQYFPKSGWVEHNANEIWNSVQSVIAGAFI--ESGIRPEAIAGIGITNQRETTVVWDKTTGQPIANAIVWQSRQSSPIADQLKVDGHTEMIHEKTGLVIDAYFSATKVRWLLDNIEGAQEKADNGELLFGTIDSWLVWKLTDGQ---VHVTDYSNASRTMLYNIHKLEWDQEILDLLNIPS-SMLPEVKSNSEVYGHTRSYEFYGS-EVPIAGMAGDQQAALFGQMAFEKGMIKNTYGTGAFIVMNTGEEPQLSDNDLLTTIGYGI--N-GKVYYALEGSIFVAGSAIQWLRDGLRMIETSPQSEELAAKAKGDNEVYVVPAFTGLGAPYWDSEARGAVFGLTRGTTKEDFVRATLQAVAYQSKDVIDTMKKDSGID-IPLLKVDGGAAKNDLLMQFQADILDIDVQRAANLETTALGAAYLAGLAVGFWKDLDELKSMAEEGQMFTPEMPAEERDNLYEGWKQAVAATQTFK
41 PsiBlast_CBE 86.0963% -70 - C3 -3H3O GLPK_ENTCA X:[4-498] -KNYVMAIDQGTTSSRAIIFDRNGKKIGSSQKEFPQYFPKSGWVEHNANEIWNSVQSVIAGAFI--ESGIRPEAIAGIGITNQRETTVVWDKTTGQPIANAIVWQSRQSSPIADQLKVDGHTEMIHEKTGLVIDAYFSATKVRWLLDNIEGAQEKADNGELLFGTIDSWLVWKLTDGQ---VHVTDYSNASRTMLYNIHKLEWDQEILDLLNIPS-SMLPEVKSNSEVYGHTRSYRFYGS-EVPIAGMAGDQQAALFGQMAFEKGMIKNTYGTGAFIVMNTGEEPQLSDNDLLTTIGYGI--N-GKVYYALEGSIFVAGSAIQWLRDGLRMIETSPQSEELAAKAKGDNEVYVVPAFTGLGAPYWDSEARGAVFGLTRGTTKEDFVRATLQAVAYQSKDVIDTMKKDSGID-IPLLKVDGGAAKNDLLMQFQADILDIDVQRAANLETTALGAAYLAGLAVGFWKDLDELKSMAEEGQMFTPEMPAEERDNLYEGWKQAVAATQTFK