@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu09440: (2016-06-14 )
MVHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEVLS

Atome Classification :

(24 SA) .........10........20........30........40........50........60........70........80........90........100-----.......------110..----------....-.120---.......130.......140.......150.......-----160..-----.....170.......180.......190.......200.......210.......220.......230--------........240-..--......250.......260.......270---.---.--.....280.......290.......300.......310.......320.......330.......340...--.--...350.......360....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MVHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALG-----ENTYTFH------PKTEE----------AIRL-IAIT---PSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQ-----PSEAK-----KKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKE---------HAEAYLKEKL--EK--GERLMGFGHRVYKTKDPRAEALRQKAEEV---A---G--NDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAE--N--NMIFRPSAQYTGAIPEEVLS
22 PsiBlast_CBE 78.27100% -86 - C6 -2C6X CISY_BACSU C:[1-363] -VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALG-----ENTYTFH------PKTEE----------AIRL-IAIT---PSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQ-----PSEAK-----KKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKE---------HAEAYLKEKL--EK--GERLMGFGHRVYKTKDPRAEALRQKAEEV---A---G--NDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAE--N--NMIFRPSAQYTGAIPEEV--
23 PsiBlast_CBE 78.21100% -86 - C6 -2C6X CISY_BACSU B:[1-363] -VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALG-----ENTYTFH------PKTEE----------AIRL-IAIT---PSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQ-----PSEAK-----KKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKE---------HAEAYLKEKL--EK--GERLMGFGHRVYKTKDPRAEALRQKAEEV---A---G--NDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAE--N--NMIFRPSAQYTGAIPEEV--
21 PsiBlast_CBE 77.95100% -86 - C6 -2C6X CISY_BACSU D:[1-363] -VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALG-----ENTYTFH------PKTEE----------AIRL-IAIT---PSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQ-----PSEAK-----KKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKE---------HAEAYLKEKL--EK--GERLMGFGHRVYKTKDPRAEALRQKAEEV---A---G--NDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAE--N--NMIFRPSAQYTGAIPEEV--
1 PsiBlast_PDB 77.94100% -86 - C6 -2C6X CISY_BACSU A:[1-363] -VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALG-----ENTYTFH------PKTEE----------AIRL-IAIT---PSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQ-----PSEAK-----KKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKE---------HAEAYLKEKL--EK--GERLMGFGHRVYKTKDPRAEALRQKAEEV---A---G--NDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAE--N--NMIFRPSAQYTGAIPEEV--
79 HHSearch 77.71100% -86 - C6 -2C6X CISY_BACSU A:[1-363] -VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALG-----ENTYTFH------PKTEE----------AIRL-IAIT---PSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQ-----PSEAK-----KKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKE---------HAEAYLKEKL--EK--GERLMGFGHRVYKTKDPRAEALRQKAEEV-------AG-NDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAE--N--NMIFRPSAQYTGAIPEEV--
5 PsiBlast_PDB 63.6540% -97 - C6 -1IXE ? A:[3-366] -VARGLEGVLFTESRMCYIDGQQGKLYYYGIPIQELAEKSSFEETTFLLLHGRLPRRQELEEFSAALARRRALPAHLLESFKRYPVSAHPMSFLRTAVSEFGMLDPTEGDISRE------ALYEK----------GLDL-IAKF---ATIVAANKRLKEGKEPIPPREDLSHAANFLYMANGVE-----PSPEQ-----ARLMDAALILHAEHGFNASTFTAIAAFSTETDLYSAITAAVASLKGPRHGGANEAVMRMIQEIGTPE---------RAREWVREKL--AK--KERIMGMGHRVYKAFDPRAGVLEKLARLV---AE-----HSKEYQILKIVEEEAGKVLN----PRGIYPNVDFYSGVVYSDLGFSLEFFTPIFAVARISGWVGHILEYQEL-D--NRLLRPGAKYVGEL------
4 PsiBlast_PDB 63.5140% -97 - C6 -1IOM ? A:[3-366] -VARGLEGVLFTESRMCYIDGQQGKLYYYGIPIQELAEKSSFEETTFLLLHGRLPRRQELEEFSAALARRRALPAHLLESFKRYPVSAHPMSFLRTAVSEFGMLDPTEGDISRE------ALYEK----------GLDL-IAKF---ATIVAANKRLKEGKEPIPPREDLSHAANFLYMANGVE-----PSPEQ-----ARLMDAALILHAEHGFNASTFTAIAAFSTETDLYSAITAAVASLKGPRHGGANEAVMRMIQEIGTPE---------RAREWVREKL--AK--KERIMGMGHRVYKAFDPRAGVLEKLARLV---AEKHG--HSKEYQILKIVEEEAGKVLN----PRGIYPNVDFYSGVVYSDLGFSLEFFTPIFAVARISGWVGHILEYQEL-D--NRLLRPGAKYVGEL------
80 HHSearch 63.4141% -96 - C6 -1IOM ? A:[3-371] -VARGLEGVLFTESRMCYIDGQQGKLYYYGIPIQELAEKSSFEETTFLLLHGRLPRRQELEEFSAALARRRALPAHLLESFKRYPVSAHPMSFLRTAVSEFG-----MLDPTEGDISRE-ALYEK----------GLDL-IAKF---ATIVAANKRLKEGKEPIPPREDLSHAANFLYMANGVE-----PSPEQ-----ARLMDAALILHAEHGFNASTFTAIAAFSTETDLYSAITAAVASLKGPRHGGANEAVMRMIQEIGTPE---------RAREWVREKL--AK--KERIMGMGHRVYKAFDPRAGVLEKLARLVA--EKH-G--HSKEYQILKIVEEEAGKVL----NPRGIYPNVDFYSGVVYSDLGFSLEFFTPIFAVARISGWVGHILEYQEL-D--NRLLRPGAKYVGELDVPYV-
26 PsiBlast_CBE 63.3340% -93 - C6 -1IXE ? B:[3-366] -VARGLEGVLFTESRMCYIDGQQGKLYYYGIPIQELAEKSSFEETTFLLLHGRLPRRQELEEFSAALARRRALPAHLLESFKRYPVSAHPMSFLRTAVSEFGMLDPTEGDISRE------ALYEK----------GLDL-IAKF---ATIVAANKRLKEGKEPIPPREDLSHAANFLYMANGVE-----PSPEQ-----ARLMDAALILHAEHGFNASTFTAIAAFSTETDLYSAITAAVASLKGPRHGGANEAVMRMIQEIGTPE---------RAREWVREKL--AK--KERIMGMGHRVYKAFDPRAGVLEKLARLV---AE------SKEYQILKIVEEEAGKVLN----PRGIYPNVDFYSGVVYSDLGFSLEFFTPIFAVARISGWVGHILEYQEL-D--NRLLRPGAKYVGEL------
48 PsiBlast_CBE 62.7534%-110 - C6 -2H12 CISY_ACEAC B:[60-425] -----------CNSKITFIDGDKGVLLHRGYPIAQLAENASYEEVIYLLLNGELPNKAQYDTFTNTLTNHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALS---------AFY------PDANDIAIPANRDLAAMRL-IAKI---PTIAAWAYKYTQGEAFIYPRNDLNYAENFLSMMFARM-----SEPYKVNPVLARAMNRILILHADHEQNASTSTVRLAGSTGANPFACIAAGIAALWGPAHGGANEAVLKMLARIGKKE---------NIPAFIAQVK--DKNSGVKLMGFGHRVYKNFDPRAKIMQQTCHEVLTEL---G--IKDDPLLDLAVELEKIALSDDYFVQRKLYPNVDFYSGIILKAMGIPTSMFTVLFAVARTTGWVSQWKEMIEEPG--QRISRPRQLYIGA-------
25 PsiBlast_CBE 62.7440% -97 - C6 -1IXE ? C:[3-366] -VARGLEGVLFTESRMCYIDGQQGKLYYYGIPIQELAEKSSFEETTFLLLHGRLPRRQELEEFSAALARRRALPAHLLESFKRYPVSAHPMSFLRTAVSEFGMLDPTEGDISRE------ALYEK----------GLDL-IAKF---ATIVAANKRLKEGKEPIPPREDLSHAANFLYMANGVE-----PSPEQ-----ARLMDAALILHAEHGFNASTFTAIAAFSTETDLYSAITAAVASLKGPRHGGANEAVMRMIQEIGTPE---------RAREWVREKL--AK--KERIMGMGHRVYKAFDPRAGVLEKLARLV-------------EYQILKIVEEEAGKVLN----PRGIYPNVDFYSGVVYSDLGFSLEFFTPIFAVARISGWVGHILEYQEL-D--NRLLRPGAKYVGEL------
96 HHSearch 62.2735%-109 - C6 -2H12 CISY_ACEAC A:[50-431] -FDPGYGETAACNSKITFIDGDKGVLLHRGYPIAQLAENASYEEVIYLLLNGELPNKAQYDTFTNTLTNHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALS-----AFYP---A-----NRDLA----------AMRL-IAKI---PTIAAWAYKYTQGEAFIYPRNDLNYAENFLSMMFARMSEPYKVNPVL-----ARAMNRILILHADHEQNASTSTVRLAGSTGANPFACIAAGIAALWGPAHGGANEAVLKMLARIGKKE---------NIPAFIAQVKDKNS--GVKLMGFGHRVYKNFDPRAKIMQQTCHEVL--TEL-GIKDDPLLDLAVELEKIALSD--DYFVQRKLYPNVDFYSGIILKAMGIPTSMFTVLFAVARTTGWVSQWKEMIE--EPGQRISRPRQLYIGAPQRDYV-
45 PsiBlast_CBE 62.0934%-113 - C6 -2H12 CISY_ACEAC E:[60-425] -----------CNSKITFIDGDKGVLLHRGYPIAQLAENASYEEVIYLLLNGELPNKAQYDTFTNTLTNHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALS---------AFY------PDANDIAIPANRDLAAMRL-IAKI---PTIAAWAYKYTQGEAFIYPRNDLNYAENFLSMMFARM-----SEPYKVNPVLARAMNRILILHADHEQNASTSTVRLAGSTGANPFACIAAGIAALWGPAHGGANEAVLKMLARIGKKE---------NIPAFIAQVK--DKNSGVKLMGFGHRVYKNFDPRAKIMQQTCHEVLTEL---G--IKDDPLLDLAVELEKIALSDDYFVQRKLYPNVDFYSGIILKAMGIPTSMFTVLFAVARTTGWVSQWKEMIEEPG--QRISRPRQLYIGA-------
46 PsiBlast_CBE 62.0734%-114 - C6 -2H12 CISY_ACEAC D:[60-425] -----------CNSKITFIDGDKGVLLHRGYPIAQLAENASYEEVIYLLLNGELPNKAQYDTFTNTLTNHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALS---------AFY------P----NRDLA-----AMRL-IAKI---PTIAAWAYKYTQGEAFIYPRNDLNYAENFLSMMFARM-----SEPYKVNPVLARAMNRILILHADHEQNASTSTVRLAGSTGANPFACIAAGIAALWGPAHGGANEAVLKMLARIGKKE---------NIPAFIAQVK--DKNSGVKLMGFGHRVYKNFDPRAKIMQQTCHEVLTEL---G--IKDDPLLDLAVELEKIALSDDYFVQRKLYPNVDFYSGIILKAMGIPTSMFTVLFAVARTTGWVSQWKEMIEEPG--QRISRPRQLYIGA-------
44 PsiBlast_CBE 62.0634%-115 - C6 -2H12 CISY_ACEAC F:[60-425] -----------CNSKITFIDGDKGVLLHRGYPIAQLAENASYEEVIYLLLNGELPNKAQYDTFTNTLTNHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALS---------AFY------PD---PANRDLA---AMRL-IAKI---PTIAAWAYKYTQGEAFIYPRNDLNYAENFLSMMFARM-----SEPYKVNPVLARAMNRILILHADHEQNASTSTVRLAGSTGANPFACIAAGIAALWGPAHGGANEAVLKMLARIGKKE---------NIPAFIAQVK--DKNSGVKLMGFGHRVYKNFDPRAKIMQQTCHEVLTEL---G--IKDDPLLDLAVELEKIALSDDYFVQRKLYPNVDFYSGIILKAMGIPTSMFTVLFAVARTTGWVSQWKEMIEEPG--QRISRPRQLYIGA-------