@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu10020: (2016-06-15 )
MERTTNFNAGPAALPLEVLQKAQKEFIDFNESGMSVMELSHRSKEYEAVHQKAKSLLIELMGIPEDYDILFLQGGASLQFSMLPMNFLTPEKTAHFVMTGAWSEKALAETKLFGNTSITATSETDNYSYIPEVDLTDVKDGAYLHITSNNTIFGTQWQEFPNSPIPLVADMSSDILSRKIDVSKFDVIYGGAQKNLGPSGVTVVIMKKSWLQNENANVPKILKYSTHVKADSLYNTPPTFAIYMLSLVLEWLKENGGVEAVEQRNEQKAQVLYSCIDESNGFYKGHARKDSRSRMNVTFTLRDDELTKTFVQKAKDAKMIGLGGHRSVGGCRASIYNAVSLEDCEKLAAFMKKFQQENE

Atome Classification :

(38 SA) .........10........20........30........40........50........60........70........80......--..--90........100.......110.-.-....-.120......----...130--...-..--.-..-140-........150.......160--.--.---......170.......180.......190.......200.......210-....-...220.---......230.......240.......250.......260.......270.......280-.......290.......300---...--.--....310.......320.......330.......340.......350.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MERTTNFNAGPAALPLEVLQKAQKEFIDFNESGMSVMELSHRSKEYEAVHQKAKSLLIELMGIPEDYDILFLQGGASLQFSMLPMNF--LT--PEKTAHFVMTGAWSEKALAETKLF-G-NTSI-TA--TSETDN----YSYIP---EVD-LT--D-VK-D-G-AYLHITSNNTIFGTQWQEF-P--N--S---PIPLVADMSSDILSRKIDVSKFDVIYGGAQKNLGPSGVTVVIMKKSWLQ-NENA-NVPKILK---YSTHVKADSLYNTPPTFAIYMLSLVLEWLKENGGVEAVEQRNEQKAQVLYSCIDESNGF-YKGHARKDSRSRMNVTFTL----RDD--E--LTKTFVQKAKDAKMIGLGGHRSVGGCRASIYNAVSLEDCEKLAAFMKKFQQENE
9 PsiBlast_PDB 100.0059% 0 - C- -4AZJ - SERC_BACAO A:[1--3] VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLN-TKVE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
23 PsiBlast_CBE 94.3359%-107 - C1 -2BIA SERC_BACAO B:[2-358] -KQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLL----VE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
1 PsiBlast_PDB 94.2859%-103 - C1 -1W23 SERC_BACAO A:[1-358] VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLN-TKVE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
27 PsiBlast_CBE 94.1559%-108 - C1 -2BI2 SERC_BACAO B:[2-358] -KQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLL----VE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
26 PsiBlast_CBE 94.0859%-108 - C1 -2BI3 SERC_BACAO B:[2-358] -KQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLL----VE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
25 PsiBlast_CBE 93.8959%-107 - C1 -2BI5 SERC_BACAO B:[2-358] -KQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLL----VE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
24 PsiBlast_CBE 93.7159%-107 - C1 -2BI9 SERC_BACAO B:[2-358] -KQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLL----VE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
28 PsiBlast_CBE 93.4159%-106 - C1 -2BI1 SERC_BACAO B:[2-358] -KQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLL----VE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
39 HHSearch 93.3159%-104 - C1 -1W23 SERC_BACAO A:[2-359] -KQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLLGE-THIA-AS--TKA-NS----YQSIP---DFS-EF--Q-LNEN-D-AYLHITSNNTIYGTQYQNF-P--E--IN--HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLN-TKVE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKEN--
4 PsiBlast_PDB 93.3059%-103 - C1 -2BI2 SERC_BACAO A:[1-358] VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLN-TKVE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
8 PsiBlast_PDB 93.1959%-103 - C1 -2BIA SERC_BACAO A:[1-358] VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLN-TKVE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
7 PsiBlast_PDB 93.1059%-102 - C1 -2BI9 SERC_BACAO A:[1-358] VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLN-TKVE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---
2 PsiBlast_PDB 93.0659%-102 - C1 -2BHX SERC_BACAO A:[1-358] VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNL--LT--KGTIGNYVLTGSWSEKALKEAKLL-G-ETHI-AA--STKANS----YQSIP---DFS-EF--Q-LN-E-NDAYLHITSNNTIYGTQYQNF-P--EI-N---HAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLN-TKVE-QVPTMLQ---YATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGF-YVGHAEKGSRSLMNVTFNL----RNE--E--LNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKE---