@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu10910: (2016-06-17 )
MTHNPNIIWHPAAISKSDRQSLNGHKSCVLWFTGLSGSGKSVLANAVDEKLYRKGIQSYVLDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILTAFISPFREDRDMVRALFPKGEFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIESDQTSISDGADLIINALQNRGII

Atome Classification :

(51 SA) .........10........20.----.......30........40........50..-......60........70........80........90........100.......110.......120---.--------..--.----....130.......140.......150.......160.......170......-.180.......190.......----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTHNPNIIWHPAAISKSDRQSL----NGHKSCVLWFTGLSGSGKSVLANAVDEKLYR-KGIQSYVLDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILTAFISPFREDRDMVRALF----P--------KG--E----FFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIESD-QTSISDGADLIINALQNRGII----
34 PsiBlast_CBE 85.5148%-118 - C2 -2OFW PAPS1_HUMAN E:[8-207] -----NVTYQAHHVSRNKRGQVVGTRGGFRGCTIWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLNERDIL----
11 PsiBlast_PDB 84.3553%-128 - C2 -2PEY PAPS1_HUMAN A:[4-179] -----------------------------RGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
32 PsiBlast_CBE 83.9648%-118 - C2 -2OFW PAPS1_HUMAN G:[8-207] -----NVTYQAHHVSRNKRGQVVGTRGGFRGCTIWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLNERDIL----
41 PsiBlast_CBE 83.8351%-123 - C2 -2AX4 PAPS2_HUMAN C:[19-196] ---------------------------GFRGCTVWLTGLSGAGKTTISFALEEYLVS-HAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIH----E--------SAGLP----FFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTN-LSTVSDCVHQVVELLQEQNIV----
36 PsiBlast_CBE 83.6548%-108 - C2 -2OFW PAPS1_HUMAN C:[8-207] -----NVTYQAHHVSRNKRGQVVGTRGGFRGCTIWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLNERDIL----
12 PsiBlast_PDB 83.6353%-122 - C2 -2PEZ PAPS1_HUMAN A:[4-179] -----------------------------RGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
40 PsiBlast_CBE 83.3351%-121 - C2 -2AX4 PAPS2_HUMAN D:[19-196] ---------------------------GFRGCTVWLTGLSGAGKTTISFALEEYLVS-HAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIH----E--------SAGLP----FFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTN-LSTVSDCVHQVVELLQEQNIV----
27 PsiBlast_CBE 83.1550%-109 - C2 -1M7G KAPS_PENCH C:[4-206] -----NITFHASALTRSERTEL----RNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATP--------GE--ETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
13 PsiBlast_PDB 82.9751%-119 - C2 -2AX4 PAPS2_HUMAN A:[19-196] ---------------------------GFRGCTVWLTGLSGAGKTTISFALEEYLVS-HAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIH----E--------SAGLP----FFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTN-LSTVSDCVHQVVELLQEQNIV----
5 PsiBlast_PDB 82.7350%-110 - C2 -1M7H KAPS_PENCH A:[7-206] --------FHASALTRSERTEL----RNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATP--------GE--ETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
10 PsiBlast_PDB 82.6548%-112 - C2 -2OFW PAPS1_HUMAN A:[8-207] -----NVTYQAHHVSRNKRGQVVGTRGGFRGCTIWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRD-KGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLNERDIL----
24 PsiBlast_CBE 82.6453%-113 - C2 -3UIE APK1_ARATH B:[4-198] -----NIKWHECSVEKVDRQRL----LDQKGCVIWVTGLSGSGKSTLACALNQMLYQ-KGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLL----P--------EG--D----FVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYL----
8 PsiBlast_PDB 82.5347%-120 - C2 -1XJQ PAPS1_HUMAN B:[34-226] ------------HVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
28 PsiBlast_CBE 82.4748%-111 - C2 -2OFX PAPS1_HUMAN B:[7-206] -----NVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
39 PsiBlast_CBE 82.4453%-151 - C2 -2PEY PAPS1_HUMAN B:[4-179] -----------------------------RGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDV--------------------EYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
42 PsiBlast_CBE 82.3551%-120 - C2 -2AX4 PAPS2_HUMAN B:[19-196] ---------------------------GFRGCTVWLTGLSGAGKTTISFALEEYLVS-HAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIH----E--------SAGLP----FFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTN-LSTVSDCVHQVVELLQEQNIV----
25 PsiBlast_CBE 82.3250%-106 - C2 -1M7H KAPS_PENCH C:[6-206] -------TFHASALTRSERTEL----RNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATP--------GE--ETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
21 PsiBlast_CBE 82.2053%-112 - C2 -4FXP APK1_ARATH C:[10-198] -----------CSVEKVDRQRL----LDQKGCVIWVTGLSGSGK-TLACALNQMLYQ-KGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLL----P--------EG--D----FVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYL----
33 PsiBlast_CBE 82.0848%-111 - C2 -2OFW PAPS1_HUMAN F:[8-207] -----NVTYQAHHVSRNKRGQVVGTRGGFRGCTIWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLNERDIL----
22 PsiBlast_CBE 82.0353%-113 - C2 -4FXP APK1_ARATH B:[1-198] --NSTNIKWHECSVEKVDRQRL----LDQKGCVIWVTGLSGSGKSTLACALNQMLYQ-KGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLL----P--------EG--D----FVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYL----
2 PsiBlast_PDB 81.9053%-111 - C2 -4FXP APK1_ARATH A:[9-198] ----------ECSVEKVDRQRL----LDQKGCVIWVTGLSGSGKSTLACALNQMLYQ-KGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLL----P--------EG--D----FVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYL----
81 HHSearch 81.7754%-110 - C2 -3UIE APK1_ARATH A:[10-198] -----------CSVEKVDRQRL----LDQKGCVIWVTGLSGSGKSTLACALNQMLYQ-KGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLL----P--------EG--D----FVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYL----
7 PsiBlast_PDB 81.6647%-122 - C2 -1X6V PAPS1_HUMAN B:[34-226] ------------HVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARA----GFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
76 HHSearch 81.3853%-116 * C2 *2PEZ PAPS1_HUMAN A:[4-178] -----------------------------RGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----EGA------SL--P----FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDI-----
1 PsiBlast_PDB 81.3653%-110 - C2 -3UIE APK1_ARATH A:[10-198] -----------CSVEKVDRQRL----LDQKGCVIWVTGLSGSGKSTLACALNQMLYQ-KGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLL----P--------EG--D----FVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYL----
4 PsiBlast_PDB 80.9750%-104 - C2 -1M7G KAPS_PENCH A:[4-206] -----NITFHASALTRSERTEL----RNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATP--------GE--ETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
23 PsiBlast_CBE 80.9053%-115 - C2 -3UIE APK1_ARATH C:[10-198] -----------CSVEKVDRQRL----LDQKGCVIWVTGLSGSGKSTLACALNQMLYQ-KGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLL----P--------EG--D----FVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLG----TSPIEMAEKVVGYLDNKGYL----
6 PsiBlast_PDB 80.7848%-108 - C2 -2OFX PAPS1_HUMAN A:[7-206] -----NVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
75 HHSearch 80.6950%-115 - C2 -1X6V PAPS1_HUMAN B:[34-225] ------------HVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----EGA------SL--P----FFEVFVDAPLHVCEQRDVKGLYKKARA----GFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDI-----
43 PsiBlast_CBE 80.1651%-115 - C2 -3CR7 KAPS_PENCH D:[1-184] ----------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVA-----------E--ETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
74 HHSearch 79.3952% -96 - C2 -1M7G KAPS_PENCH A:[4-206] -----NITFHASALTRSERTEL----RNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLH----EVATPGEETGL--P----FVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
9 PsiBlast_PDB 79.3747%-108 - C2 -1XNJ PAPS1_HUMAN B:[34-226] ------------HVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVC-HGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIH----E--------GA--SLP--FFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTD-SCDVNDCVQQVVELLQERDIV----
3 PsiBlast_PDB 77.9850%-122 - C2 -1D6J KAPS_PENCH A:[8-206] ---------HASALTRSERTEL----RNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATP--------GE--ETGLPFVEVYVDVPVE--------------------------APYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
26 PsiBlast_CBE 77.8950%-114 - C2 -1M7G KAPS_PENCH D:[23-206] ----------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAT--------------TGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY-ELPVQDAVKQIIDYLDTKGYL----
79 HHSearch 76.3453%-111 - C2 -4BZP ? A:[3-173] ----------------------------PRGKTVWFTGLSGSGKSSVAMLVERKLLE-KGISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVH----ADA------GI--D----FFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPD--RSIDEQAQEVIDLLE---------
15 PsiBlast_PDB 75.9853%-115 - C2 -4BZP ? A:[7-174] --------------------------------TVWFTGLSGSGKSSVAMLVERKLLE-KGISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVH----A--------DAGID----FFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPD-R-SIDEQAQEVIDLLES--------
44 PsiBlast_CBE 75.3253%-113 - C2 -4BZP ? B:[7-174] --------------------------------TVWFTGLSGSGKSSVAMLVERKLLE-KGISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVH----A--------DAGID----FFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPD-R-SIDEQAQEVIDLLES--------
17 PsiBlast_PDB 75.0053%-108 - C2 -4BZX CYSNC_MYCTU A:[6-173] --------------------------------TVWFTGLSGSGKSSVAMLVERKLLE-KGISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVH----A--------DAGID----FFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPD-R-SIDEQAQEVIDLLES--------
16 PsiBlast_PDB 74.7353%-106 - C2 -4BZQ CYSNC_MYCTU A:[6-173] --------------------------------TVWFTGLSGSGKSSVAMLVERKLLE-KGISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVH----A--------DAGID----FFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPD-R-SIDEQAQEVIDLLES--------
45 PsiBlast_CBE 74.0753%-107 - C2 -4BZX B:[6-173] --------------------------------TVWFTGLSGSGKSSVAMLVERKLLE-KGISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVH----A--------DAGID----FFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPD-R-SIDEQAQEVIDLLES--------
46 PsiBlast_CBE 73.5953%-108 - C2 -4BZQ B:[6-173] --------------------------------TVWFTGLSGSGKSSVAMLVE