@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu11220: (2016-06-17 )
MSSLFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDSVWHVSNLFQNSLQEQAAQKLAAHSAGDLVFFCNSGAEANEGAIKLARKATGKTKIITFLQSFHGRTYAGMAATGQDKIKTGFGPMLGGFHYLPYNDPSAFKALGEEGDIAAVMLETVQGEGGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGIGRTGKGFAYEHFGLSPDIITVAKGLGNGFPVGAVIGKKQLGEAFTPGSHGTTFGGNMLAMAAVNATLQIVFQPDFLQEAADKGAFLKEQLEAELKSPFVKQIRGKGLMLGIECDGPVADIIAELQTLGLLVLPAGPNVIRLLPPLTVTKDEIAEAVSKLKQAIAHHSAVNQ

Atome Classification :

(51 SA) .........10........20........30........40....-....50........60....-..-..70........80....--..-.---.90........100......--------.------110------.-----..-----......120.......130.......140-.......150.----------------...-...--------------------------160...--....170....-...180.......190.......200.......210.......220.......230.......240-.-....-..250.......-------260.......270.......280.......290....-...300....-..--.310.--.......320.....----.-.330-----------..---.-......-340........350.......360.......370.......380...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSSLFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGH-CHEAVTEAVKKQLDSVWHVS-NL-FQNSLQEQAAQKLAAHSA--GD-L---VFFCNSGAEANEGAIKLARK--------A------T--------G-----KT-----KIITFLQSFHGRTYAGMAATGQDKIKTGF-GPMLGGFHYLP----------------YND-PSA--------------------------FKALGE--EGDIAAVMLET-VQGEGGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGIGRTGKGFAYEHFGLSPDIITVAKGLGNG-F-PVGA-VIGKKQLGEAFT-------PGSHGTTFGGNMLAMAAVNATLQIVFQPDFLQEAADK-GAFLKEQLEA-EL--KS-PF--VKQIRGKGLMLGIEC----D-GP-------------VA---D-IIAELQ-TL-GLLVLPAGPNVIRLLPPLTVTKDEIAEAVSKLKQAIAHHSAVNQ
109 HHSearch 86.5241%-106 - C1 -3NX3 ARGD_CAMJE A:[13-394] -----PTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGY-NHAKFNAKIKAQVDKLLHTS-NL-YYNENIAAAAKNLAKASA--LE-R---VFFTNSGTESIEGAMKTARK--------Y------AFNKGV---K-----GG-----QFIAFKHSFHGRTLGALSLTANEKYQKPF-KPLISGVKFAK----------------YND-ISS--------------------------VEKLV---NEKTCAIILES-VQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCG-L-SVGA-FVINQKVASNSLE------AGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKL-TPYLEQSLDE-LI--NEFDF--CKKRKGLGFMQGLSL----D-KSVK-----------VA---K-VIQKCQ-EN-ALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKS------
57 PsiBlast_CBE 85.1733%-108 - C1 -1OAT OAT_HUMAN C:[53-436] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALE-VLEEENLAENADKLGIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
112 HHSearch 83.2539% -98 - C1 -4ADB ASTC_ECOLI A:[15-402] ----IPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGH-AHPELREALNEQASKFWHTG-NG-YTNEPVLRLAKKLIDATF--AD-R---VFFCNSGAEANEAALKLARK--------FAHDRYGS--------H-----KS-----GIVAFKNAFHGRTLFTVSAGGQPAYSQDF-APLPADIRHAA----------------YND-INS--------------------------ASALI---DDSTCAVIVEP-IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGG-F-PVGA-LLATEECARVMT-------VGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR-HDWFVERLNT-IN--HRYGL--FSEVRGLGLLIGCVL----N-ADYAGQ---------AK---Q-ISQEAA-KA-GVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHFVS---
19 PsiBlast_PDB 83.2541%-104 - C1 -3NX3 ARGD_CAMJE A:[9-392] -SHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGY-NHAKFNAKIKAQVDKLLHTS-NL-YYNENIAAAAKNLAKASA--LE-R---VFFTNSGTESIEGAMKTARK--------Y------A--------F-----NKGVKGGQFIAFKHSFHGRTLGALSLTANEKYQKPF-KPLISGVKFAK----------------YND-ISS--------------------------VEKLVN--E-KTCAIILES-VQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCG-L-SVGAFVINQKVASNSLE-------AGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKL-TPYLEQSLDE-LI--NEFDF--CKKRKGLGFMQGLSL----D-KSVK-----------VA---K-VIQKCQ-EN-ALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKAL--------
2 PsiBlast_PDB 82.8443% -98 - C1 -2E54 ARGD_THEMA A:[3-382] ---LMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGH-SHPRLVEAIKDQAEKLIHCS-NL-FWNRPQMELAELLSKNTF--GG-K---VFFANTGTEANEAAIKIARK--------Y------G--------K-----KKSEKKYRILSAHNSFHGRTLGSLTATGQPKYQKPF-EPLVPGFEYFE----------------FNN-VED--------------------------LRRKMS--E-DVCAVFLEP-IQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGG-V-PIGA-VIVNER-ANVLE-------PGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEK-GNYLMKKLQ--EM--KE-EYDVVADVRGMGLMIGIQF----R-EE-------------VSNR-E-VATKCF-EN-KLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVL--------
54 PsiBlast_CBE 82.5933%-111 - C1 -2OAT OAT_HUMAN C:[53-436] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALE-VLEEENLAENADKLGIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
58 PsiBlast_CBE 82.5433%-109 - C1 -1OAT OAT_HUMAN B:[53-436] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALE-VLEEENLAENADKLGIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
59 PsiBlast_CBE 82.1633%-109 - C1 -1OAT OAT_HUMAN A:[53-436] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALE-VLEEENLAENADKLGIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
24 PsiBlast_CBE 81.8841%-104 - C1 -1VEF ARGD_THET8 B:[23-395] ------VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGH-GNPEVVEAVKRQAETLMAMP-QT-LPTPMRGEFYRTLTAILP--PE-LNR-VFPVNSGTEANEAALKFARA--------H------T--------G-----RK-----KFVAAMRGFSGRTMGSLSVTWEPKYREPF-LPLVEPVEFIP----------------YND-VEA--------------------------LKRAVD--E-ETAAVILEP-VQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-V-PLGV-AVMREEVARSMP-------KGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAEL-GPWFMEKLRA--I--PS-PK--IREVRGMGLMVGLEL----K-EK-------------AA---P-YIARLE-KEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA-------
5 PsiBlast_PDB 81.8541%-105 - C1 -1WKG ARGD_THET8 A:[23-395] ------VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGH-GNPEVVEAVKRQAETLMAMP-QT-LPTPMRGEFYRTLTAILP--PE-LNR-VFPVNSGTEANEAALKFARA--------H------T--------G-----RK-----KFVAAMRGFSGRTMGSLSVTWEPKYREPF-LPLVEPVEFIP----------------YND-VEA--------------------------LKRAVD--E-ETAAVILEP-VQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-V-PLGV-AVMREEVARSMP-------KGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAEL-GPWFMEKLRA--I--PS-PK--IREVRGMGLMVGLEL----K-EK-------------AA---P-YIARLE-KEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA-------
6 PsiBlast_PDB 81.6541%-102 - C1 -1WKH ARGD_THET8 A:[23-395] ------VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGH-GNPEVVEAVKRQAETLMAMP-QT-LPTPMRGEFYRTLTAILP--PE-LNR-VFPVNSGTEANEAALKFARA--------H------T--------G-----RK-----KFVAAMRGFSGRTMGSLSVTWEPKYREPF-LPLVEPVEFIP----------------YND-VEA--------------------------LKRAVD--E-ETAAVILEP-VQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-V-PLGV-AVMREEVARSMP-------KGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAEL-GPWFMEKLRA--I--PS-PK--IREVRGMGLMVGLEL----K-EK-------------AA---P-YIARLE-KEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA-------
103 HHSearch 81.4743% -99 - C1 -4JF1 ARGD_SALTY A:[35-420] ------VYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGH-CHPALVEALKSQGETLWHTS-NV-FTNEPALRLGRKLIDATF--AE-R---VLFMNSGTEANETAFKLARH--------Y------ACVRHSP--F-----KT-----KIIAFHNAFHGQSLFTVSVGGQPKYSDGF-GPKPADIIHVP----------------FND-LHA--------------------------VKAVM---DDHTCAVVVEP-IQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG-F-PVSA-MLTTQEIASAF-------------STYGGNPLACAVAGATFDIINTPEVLQGIHTK-RQQFVQHLQA-ID--EQFDI--FSDIRGMGLLIGAEL----K-PKYKGR---------AR---D-FLYAGA-EA-GVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKVVA---
4 PsiBlast_PDB 81.4541%-104 - C1 -1VEF ARGD_THET8 A:[23-395] ------VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGH-GNPEVVEAVKRQAETLMAMP-QT-LPTPMRGEFYRTLTAILP--PE-LNR-VFPVNSGTEANEAALKFARA--------H------T--------G-----RK-----KFVAAMRGFSGRTMGSLSVTWEPKYREPF-LPLVEPVEFIP----------------YND-VEA--------------------------LKRAVD--E-ETAAVILEP-VQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-V-PLGV-AVMREEVARSMP-------KGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAEL-GPWFMEKLRA--I--PS-PK--IREVRGMGLMVGLEL----K-EK-------------AA---P-YIARLE-KEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA-------
63 PsiBlast_CBE 80.8132%-111 - C1 -1GBN OAT_HUMAN C:[16-399] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKL-GIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
65 PsiBlast_CBE 80.7932%-110 - C1 -1GBN OAT_HUMAN A:[16-399] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKL-GIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
21 PsiBlast_CBE 80.6545%-101 - C1 -2EH6 ARGD_AQUAE B:[1-375] -TYLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGH-AYPKLTEALKEQVEKLLHVS-NL-YENPWQEELAHKLVKHFW--TEGK---VFFANSGTESVEAAIKLARKYWRDK---G------K--------N-----KW-----KFISFENSFHGRTYGSLSATGQPKFHKGF-EPLVPGFSYAK----------------LNDIDSV--------------------------YKLLDE--E--TAGIIIEV-IQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGG-V-PIGA-ILAREEVAQSFT-------PGSHGSTFGGNPLACRAGTVVVDEV--EKLLPHVREV-GNYFKEKLKE-LG--KG-------KVKGRGLMLGLEL----E-RE-------------CK---D-YVLKAL-EK-GLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL--------
56 PsiBlast_CBE 80.2633%-108 - C1 -2OAT OAT_HUMAN A:[53-436] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALE-VLEEENLAENADKLGIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
64 PsiBlast_CBE 80.1532%-110 - C1 -1GBN OAT_HUMAN B:[16-399] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKL-GIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
60 PsiBlast_CBE 80.1232%-108 - C1 -2CAN OAT_HUMAN C:[16-399] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKL-GIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
61 PsiBlast_CBE 80.0432%-108 - C1 -2CAN OAT_HUMAN B:[16-399] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKL-GIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
70 PsiBlast_CBE 79.9334%-113 - C1 -2BYL OAT_HUMAN C:[60-436] ------------VALERGKGIYLWDVEGRKYFDFLSSISAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHFSTYGGNPLGCRVAIAALE-VLEEENLAENADKLGIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------
120 HHSearch 79.8843% -98 - C1 -2ORD ARGD_THEMA A:[21-396] ---------RFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGH-SHPRLVEAIKDQAEKLIHCS-NL-FWNRPQMELAELLSKNTF--GG-K---VFFANTGTEANEAAIKIARK--------Y------G--------KKKSEKKY-----RILSAHNSFHGRTLGSLTATGQPKYQKPF-EPLVPGFEYFE----------------FNN-VED--------------------------LRRKM---SEDVCAVFLEP-IQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGG-V-PIGA-VIVNERAN-VLE-------PGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEK-GNYLMKKLQE-MK--EEYDV--VADVRGMGLMIGIQF----R-EEVS-----------NR---E-VATKCF-EN-KLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVLQG------
115 HHSearch 79.6541%-101 * C1 *1VEF ARGD_THET8 A:[23-395] ------VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGH-GNPEVVEAVKRQAETLMAMP-QT-LPTPMRGEFYRTLTAILPPELN-R---VFPVNSGTEANEAALKFARA--------H------T--------G-----RK-----KFVAAMRGFSGRTMGSLSVTWEPKYREPF-LPLVEPVEFIP----------------YND-VEA--------------------------LKRAV---DEETAAVILEP-VQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-V-PLGV-AVMREEVARSMP-------KGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAEL-GPWFMEKLRA-IP--SP--K--IREVRGMGLMVGLEL----K-EK-------------AA---P-YIARLEKEH-RVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA-------
55 PsiBlast_CBE 79.6033%-108 - C1 -2OAT OAT_HUMAN B:[53-436] -----HNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RA-FYNNVLGEYEEYITKLFN--YH-K---VLPMNTGVEAGETACKLARKWGYTVKGIQ------K--------Y-----KA-----KIVFAAGNFWGRTLSAISSSTDPTSYDGF-GPFMPGFDIIP----------------YND-LPA--------------------------LERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLY-PVSA-VLCDDDIMLTIK-------PGEHGSTYGGNPLGCRVAIAALE-VLEEENLAENADKLGIILRNEL-M-KL--PS-DV--VTAVRGKGLLNAIVIKETKD-WD-------------AW---K-VCLRLR-DN-GLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI--------