@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu11820: (2016-06-18 )
MKCARLNDRIIHLHTYSREHYQFLFEEGIKGHLFCSHCGKPVLLRLNIADPPEFIHRQPGDFPACEEACEPKPSKEGKKEDDQESGVIRLPKGKAIAADPSPAVTEWHRPRSIKPGTPFVPKTIEPDTSLFPSVGLNTDQLKAVTETEGPLLVLAGAGSGKTRVLTARAAHMIEHLGIPPENMLLVTFTTKAVAEMKERMANQYGLQPAKVRRIVTGTFHSLFYKILYHSNSAKWNGEHLLKMEWQREQYIKKALYEEGIDEKESPVDQALQQIGFWKNTYVPNERIPLKDEWEKQVYRLYEHYERQKKEHSQFDFDDMASACYELFIERPDLLEQYQSRFTYILIDEFQDINPVQYKIMQMLASPEQNLCCVGDDDQSIYAFRGSNPSFILDFQKDYPGAKTIYLTANYRSTHPIVSSADIVVKKNKNRYAKTLEAARDDIQVPVLFYPYDEEEEATMVVSDIKEKIQNGASPEDFAVLYRTNSGGRAIYERLHQSSIPYTADRGVQSFYSRRIVRQILAYLYASQNEDDTEAIKHLLPALFLKQSALNTLKALSITEDCTMIKALAKLPDLKPFQLDKIKKIVPFFASLRTMKPVEAITFAEGKMGFSEYLKKRGNEGNKLEKGSDDLRDIKVVAKKFKTIPDFLAHVDHMRAAEKNRTDEHGVQLMTIHRSKGLEFKTVYVLGTVDGSIPHDFSLETARKGDEAALEEERRLLYVAMTRAKQHLYLSCPANRRGKTANRSRFLYPLLQKARQPLHH

Atome Classification :

(22 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170....--...180.......190.......200.......---------------210.......220.....--..230.-.......240-----.........250.....-..260------------....----------------------------.-----------.-------------------------.270.......280-----------------------------....-----------------...-----..--------------------290----..--......-.300.......310.......320.......330---.........340.......350.......360....---...370.......380.......390.......400---.........410.......420.......430..----------....--.440...--...-.-450.......460......-.----------470...-.....480.......490.......500.......510.......520.......530...--....--540...--..--..550.......560.......570---.-....------------...580.......590---.--------.......600.......610..-...----..620---------.......---..630......-----.--------640----..-------...------------....650...-..----.----.---660.......670.......680.......690.......700----------------------------........710.......720.......730....----.--.---.--740.......750.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKCARLNDRIIHLHTYSREHYQFLFEEGIKGHLFCSHCGKPVLLRLNIADPPEFIHRQPGDFPACEEACEPKPSKEGKKEDDQESGVIRLPKGKAIAADPSPAVTEWHRPRSIKPGTPFVPKTIEPDTSLFPSVGLNTDQLKAVTETEGPLLVLAGAGSGKTRVLTARAAHMIEHL--GIPPENMLLVTFTTKAVAEMKERMANQYGLQPA---------------KVRRIVTGTFHSLFYKIL--YHS-NS-AKWNGEHL-------LKMEWQREQYIKKALYE-EGIDE------------KESP----------------------------V-----------D-------------------------QALQQIGFWKNT-------------------------------YVPN-----------------ERI-----PL--------------------K------DE--WEKQVY-RLYEHYERQKKEHSQFDFDDMASACYELFIER-----PDLLEQYQSRFTYILIDEFQDINPVQYKIMQMLASP---EQNLCCVGDDDQSIYAFRGSNPSFILDFQKDYPG-----AKTIYLTANYRSTHPIVSSADIVVKKNKNRYAKT----------LEAA--RDDIQVP--VLF-Y-PYDEEEEATMVVSDIKEKI-Q----------N-GASP-EDFAVLYRTNSGGRAIYERLHQSSIPYTADRGVQSFYSRRIVRQILAYLYASQNEDDTEAI--KHLL--PALFLK--QS--ALNTLKALSITEDCTMIKALAKL-P---D-LKPF------------QLDKIKKIVPFFASL----R--------TMKPVEAITFAEGKMGFSEYLK-KRG----NEG-----------NKLEKGS---DDLRDIKVVAK-----K--------F------KT-------IPD------------FLAHVDHMRA-AE----K----N---RTDEHGVQLMTIHRSKGLEFKTVYVLGTVDGSIPHDFSLETA-----------------------------RKGDEAALEEERRLLYVAMTRAKQHLYLSCPANRR----G--K---T--ANRSRFLYPLLQKARQPLHH
5 PsiBlast_PDB 85.8032% -88 - C1 -2IS2 UVRD_ECOLI A:[10-619] ---------------------------------------------------------------------------------------------------------------------------------------LNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVE--NCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQG---------------G---MWVGTFHGLAHRLLRAHHM-DA-NLPQDFQI-------LDSEDQL-RLLKRLIKA-MNLDE------------KQWP----------------------------P-----------R-------------------------QAMWYINSQKDE-------------------------------GLRP-----------------HHIQSYGNPV--------------------E------QT--WQK-----VYQAYQEACDRAGLVDFAELLLRAHELWLNK-----PHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGD---TGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPG-----AETIRLEQNYRSTSNILSAANALIENNNGRLGKK----------LWTD--GADGEPI--SLY-C-AFNELDEARFVVNRIKTWQ-D----------N-GGAL-AECAILYRSNAQSRVLEEALLQASMPYRIYGGMR-FFERQEIKDALSYLRLIVNRNDDAAF--ERVVNTPTRGIG--DR--TLDVVRQTSRDRQLTLWQACREL-L---Q-EKALAGRAAS------ALQRFMELIDALAQE----T--------ADMPLHVQT--------DRVIK-DSGLRTMYEQ-----------EKGEKGQTRIENLEELVTATR-----Q--------F------SYDEDLMP-LQA------------FLSHAALEAG-EG----Q----A---DTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEG-----------------------------GR-----LEEERRLAYVGVTRAMQKLTLTYAETRR----------------------------------
4 PsiBlast_PDB 85.7632% -89 - C1 -2IS1 UVRD_ECOLI A:[10-619] ---------------------------------------------------------------------------------------------------------------------------------------LNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVE--NCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQG---------------G---MWVGTFHGLAHRLLRAHHM-DA-NLPQDFQI-------LDSEDQL-RLLKRLIKA-MNLDE------------KQWP----------------------------P-----------R-------------------------QAMWYINSQKDE-------------------------------GLRP-----------------HHIQSYGNPV--------------------E------QT--WQK-----VYQAYQEACDRAGLVDFAELLLRAHELWLNK-----PHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGD---TGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPG-----AETIRLEQNYRSTSNILSAANALIENNNGRLGKK----------LWTD--GADGEPI--SLY-C-AFNELDEARFVVNRIKTWQ-D----------N-GGAL-AECAILYRSNAQSRVLEEALLQASMPYRIYGGMR-FFERQEIKDALSYLRLIVNRNDDAAF--ERVVNTPTRGIG--DR--TLDVVRQTSRDRQLTLWQACREL-L---Q-EKALAGRAAS------ALQRFMELIDALAQE----T--------ADMPLHVQT--------DRVIK-DSGLRTMYEQ-----------EKGEKGQTRIENLEELVTATR-----Q--------F------SYNEDLMP-LQA------------FLSHAALEAG-EG----Q----A---DTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEG-----------------------------GR-----LEEERRLAYVGVTRAMQKLTLTYAETRR----------------------------------
39 HHSearch 84.1926% 0 - C- -3U4Q - ADDA_BACSU A:[10-936] --------------------------------------------------------------------------------------------------------------------------------------TWTDDQWNAIVSTGQDILVAAAAGSGKTAVLVERMIRKITAEENPIDVDRLLVVTFTNASAAEMKHRIAEA--LEKELVQRPGSLHIRRQLSLLNRASISTLHSFCLQVL--KKY-YYLIDLDPGFR-------IADQTEGELIGDEVLDE-LFEDEYAKGEKAFFELVDRYTTDRHDLDLQFLVKQVYEYSRSHPNPEAWLESFVHLYDVSEKSAIEELPFYQYVKEDIAMVLNGAKEKLLRALELT---DNFLDDLAQIDELIQHQDDFSELYKRVPAVS--DPALLDEATDLRNGAKKLLEKL-----KTDYFTRSPEQHLKSLAEMKPVI------ET--LVQLVI-SYGKRFEAAKQEKSIIDFSDLEHYCLAILTAENDREPSEAARFYQEQFHEVLVDEYQDTNLVQESILQLVTSGPEETGNLFMVGDVKQSIYRFRLAEPLLFLSKYKRFTESGEGTGRKIDLNKNFRSRADILDSTNFLFKQLMGGKIGEVDYDEQAELKLGAAYPDNDETETELLLID--LETVQFEAKAIAKEIRKLI-SSPFKVYKKTHR-NIQY-RDIVILLRSMPWAPQIMEELRAQGIPVYANL-TSGYFEAVEVAVALSVLKVIDNPYQDIPL--ASVL--RSPIVG--ADENELSLIRLENK--KAPYYEAMKDYLAAG-D-RSDE------------LYQKLNTFYGHLQKWRAFSK--------NHSVSELIWEVYRDTKYMDYVG-GMP----G---------------GKQRQ---ANLRVLYDRAR-----Q--------YESTAF-RG-------LFR------------FLRFIERMQE-RG----D----------QEDVVRLMTIHSSKGLEFPVVFVAGLGRNFNMMDLNKSYLLDKELGFGTKYIHPQLRISYPTLPLIAMKKKMRRELLSEELRVLYVALTRAKEKLFLIGSCKD-----------------------------------
35 HHSearch 82.5134% -84 - C1 -1PJR - PCRA_GEOSE A:[8-645] -----------------------------------------------------------------------------------------------------------------------------------LLAHLNKEQQEAVRTTEGPLLIMAGAGSGKTRVLTHRIAYLMAEK--HVAPWNILAITFTNKAAREMRERVQSL--LGG----------------AAEDVWISTFHSMCVRIL--RRD-IDRIGINRNFS-------ILDPTDQLSVMKTILKE-KNIDP------------KKFE----------------------------P-----------R-------------------------TILGTISAAKNE-------------------------------LLPP-----------------EQF-----AKR---------------------------Y--YEKVVS-DVYQEYQQRLLRNHSLDFDDLIMTTIQLFDRV-----PDVLHYYQYKFQYIHIDEYQDTNRAQYTLVKKLAER---FQNICAVGDADQSIYRWRGADIQNILSFERDYPN-----AKVILLEQNYRSTKRILQAANEVIEHNVNRKPKR----------IWTE--NPEGKPI--LYY-E-AMNEADEAQFVAGRIREAV-E----------RGERRY-RDFAVLYRTNAQSRVMEEMLLKANIPYQIVG-GLKFYDRKEIKDILAYLRVIANPDDDLSL--LRII--NVPKRGIGAS--TID------------LFEALGEL-EMI-G-LGAK------------AAGALAAFRSQLEQW----TQLQE----YVSVTELVEEVLDKSGYREMLK-AER------T-----------IEAQSRL---ENLDEFLSVTK-----H--------FENVSDDKS-------LIA------------FLTDLALIS--------------------GDAVMLMTLHAAKGLEFPVVFLIGMEEGIFPHNRSLE----------------------------------DDDEMEEERRLAYVGITRAEEELVLTSAQMRTLF--GNIQ---M--DPPSRFLNEIPAHL------
6 PsiBlast_PDB 82.2332% -78 - C1 -2IS6 UVRD_ECOLI A:[10-619] ---------------------------------------------------------------------------------------------------------------------------------------LNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVE--NCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQG---------------G---MWVGTFHGLAHRLLRAHHM-DA-NLPQDFQI-------LDSEDQL-RLLKRLIKA-MNLDE------------KQWP----------------------------P-----------R-------------------------QAMWYINSQKDE-------------------------------GLRP-----------------HHIQSYGNPV--------------------E------QT--WQK-----VYQAYQEACDRAGLVDFAELLLRAHELWLNK-----PHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGD---TGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPG-----AETIRLEQNYRSTSNILSAANALIENNNGRLGKK----------LWTD--GADGEPI--SLY-C-AFNELDEARFVVNRIKTWQ-D----------N-GGAL-AECAILYRSNAQSRVLEEALLQASMPYRIYGGMR-FFERQEIKDALSYLRLIVNRNDDAAF--ERVVNTPTRGIG--DR--TLDVVRQTSRDRQLTLWQACREL-L---Q-EKALAGRAAS------ALQRFMELIDALAQE----T--------ADMPLHVQT--------DRVIK-DSGLRTMYEQ-----------EKGEKGQTRIENLEELVTATR-----Q--------F------SYNEEDLMPLQA------------FLSHAALEAG-EG----Q----A---DTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEG-----------------------------GR-----LEEERRLAYVGVTRAMQKLTLTYAETRR----------------------------------
34 HHSearch 81.1931% -79 * C1 *4C2T ? A:[9-652] -----------------------------------------------------------------------------------------------------------------------------------LLQALNPTQAQAADHFTGPALVIAGAGSGKTRTLIYRIAHLIGHY--GVHPGEILAVTFTNKAAAEMRERAGHL--VP-----------------GAGDLWMSTFHSAGVRIL--RTY-GEHIGLRRGFV-------IYDDDDQLDIIKEVMGS-IPGIG------------AETQ----------------------------P-----------R-------------------------VIRGIIDRAKSN-------------------------------LWTP-----------------DDL-----DR--------------------SREPFISGL--PRDAAA-EAYRRYEVRKKGQNAIDFGDLITETVRLFKEV-----PGVLDKVQNKAKFIHVDEYQDTNRAQYELTRLLASR---DRNLLVVGDPDQSIYKFRGADIQNILDFQKDYPD-----AKVYMLEHNYRSSARVLEAANKLIENNTERLDKT----------LKPV--KEAGQPV--TFH-R-ATDHRAEGDYVADWLTRLH-G----------E-GRAW-SEMAILYRTNAQSRVIEESLRRVQIPARIVG-GVGFYDRREIRDILAYARLALNPADDVAL--RRII--GRPRRGIGDT--ALQKLMEWARTHHTSVLTACANA-AEQ-N-ILDR------------GAHKATEFAGLMEAM----SEAAD----NYEPAAFLRFVMETSGYLDLLR-QEG------------------QEGQVRL---ENLEELVSAAE-----EWSQDEANVG------GS-------IAD------------FLDDAALLSS-------DMRTKA------EDAVTLMTLHNAKGLEFPVVFIVGVEQGLLPSKGAIA---------------------------------EGPSGIEEERRLFYVGITRAMERLLMTAAQNRMQF--GKTN---A--AEDSAFLEDIEGLF------
21 PsiBlast_CBE 80.2832% -89 - C1 -2IS1 UVRD_ECOLI B:[10-619] ---------------------------------------------------------------------------------------------------------------------------------------LNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVE--NCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQG---------------G---MWVGTFHGLAHRLLRAHHM-DA-NLPQDFQI-------LDSEDQL-RLLKRLIKA-MNLDE------------KQWP----------------------------P-----------R-------------------------QAMWYINSQKDE-------------------------------GLRP-----------------HHIQS----V--------------------E------QT--WQK-----VYQAYQEACDRAGLVDFAELLLRAHELWLNK-----PHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGD---TGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPG-----AETIRLEQNYRSTSNILSAANALIENNNGRLGKK----------LWTD--GADGEPI--SLY-C-AFNELDEARFVVNRIKTWQ-D----------N-GGAL-AECAILYRSNAQSRVLEEALLQASMPYRIYGGMR-FFERQEIKDALSYLRLIVNRNDDAAF--ERVVNTPTRGIG--DR--TLDVVRQTSRDRQLTLWQACREL-L---Q-EKALAGRAAS------ALQRFMELIDALAQE----T--------ADMPLHVQT--------DRVIK-DSGLRTMYEQ-----------EKGEKGQTRIENLEELVTATR-----Q--------F------SYDEDLMP-LQA------------FLSHAALEAG-EG----------------QDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQM-----------------------------------R-----LEEERRLAYVGVTRAMQKLTLTYAETRR----------------------------------
25 PsiBlast_CBE 80.0633% -79 - C1 -4C30 ? D:[13-645] ---------------------------------------------------------------------------------------------------------------------------------------LNPTQAQAADHFTGPALVIAGAGSGKTRTLIYRIAHLIGHY--GVHPGEILAVTFTNKAAAEMRERAGH---LVPG----------------AGDLWMSTFHSAGVRIL----------RTYGEHIGLRRGFVIYDDDDQLDIIKEVMGSIPG---------------ETQPRVIRGI----------------------I-----------D-------------------------RAKSNL--WTPD-------------------------------DLDR-----------------SRE-----PF--------------------I------SG--LPRDAAAEAYRRYEVRKKGQNAIDFGDLITETVRLFKEV-----PGVLDKVQNKAKFIHVDEYQDTNRAQYELTRLLASR---DRNLLVVGDPDQSIYKFRGADIQNILDFQKDYPD-----AKVYMLEHNYRSSARVLEAANKLIENNTERLDKT----------LKPV--KEAGQ-P--VTF-HRATDHRAEGDYVADWLTRLH-G----------E-GRAW-SEMAILYRTNAQSRVIEESLRRVQIPARIVGGV-GFYDRREIRDILAYARLALNPADDVALRRIIGR--PRRGIG--DT--ALQKLMEWARTHHTSVLTACANA-A---E-QNI--------------LDRGAHKATEFAGL----MEAMSEAADNYEPAAFLRFVMETSGYLDLLR-QEG----QEGQVRLENLEELVSAAEEWS---QDEA---GSIA-----D--------F------LD-------DAA------------LLSSVDD-------------------GAPEDAVTLMTLHNAKGLEFPVVFIVGVEQGLLPSKGAIAEG-----------------------------PSG----IEEERRLFYVGITRAMERLLMTAAQNRMQF--G--K---TNAAEDSAFL-------------
36 HHSearch 79.8130% -84 - C1 -1UAA REP_ECOLI A:[2-638] --------------------------------------------------------------------------------------------------------------------------------------RLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGC--GYQARHIAAVTFTNKAAREMKERVGQT--LGRK---------------EARGLMISTFHTLGLDII--KRE-YAALGMKANFS-------LFDDTDQLALLKELTEG-LIEDD------------K-VL----------------------------L-----------Q-------------------------QLISTISNWKND-------------------------------LKTP-----------------SQA-----AASA------------------I------GE--RDRIFA-HCYGLYDAHLKACNVLDFDDLILLPTLLLQAN-----EEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVGS---RARFTVVGDDDQSIYSWRGARPQNLVLLSQDFPA-----LKVIKLEQNYRSSGRILKAANILIANNPHVFEKR----------LFSE--LGYGAEL--KVL-S-ANNEEHEAERVTGELIAHHFV----------N-KTQY-KDYAILYRGNHQSRVFEKFLMQNRIPYKISG-GTSFFSRPEIKDLLAYLRVLTNPDDDSAF--LRIV--NTPKREIGPA--TLKKLGEWAMTRNKSMFTASFDM-GLSQT-LSGR------------GYEALTRFTHWLAEI----QRLA-----EREPIAAVRDLIHGMDYESWLY-ETSPSPKAAE-----------MRMKNVN---QLFSWMTEMLEGSELDE--------P------MT-------LTQ------------VVTRFTLRDM-ME----R--------EEELDQVQLMTLHASKGLEFPYVYMVGMEEGFLPHQSSI-----------------------------------DEDNIDEERRLAYVGITRAQKELTFTLCKERRQYGEL--V---R--PEPSRFLLELPQDDL-----
23 PsiBlast_CBE 79.6833% -79 - C1 -4C30 ? I:[13-645] ---------------------------------------------------------------------------------------------------------------------------------------LNPTQAQAADHFTGPALVIAGAGSGKTRTLIYRIAHLIGHY--GVHPGEILAVTFTNKAAAEMRERAGH---LVPG----------------AGDLWMSTFHSAGVRIL----------RTYGEHIGLRRGFVIYDDDDQLDIIKEVMGSIPG---------------ETQPRVIRGI----------------------I-----------D-------------------------RAKSNL--WTPD-------------------------------DLDR-----------------SRE-----PF--------------------I------SG--LPRDAAAEAYRRYEVRKKGQNAIDFGDLITETVRLFKEV-----PGVLDKVQNKAKFIHVDEYQDTNRAQYELTRLLASR---DRNLLVVGDPDQSIYKFRGADIQNILDFQKDYPD-----AKVYMLEHNYRSSARVLEAANKLIENNTERLDKT----------LKPV--KEAGQ-P--VTF-HRATDHRAEGDYVADWLTRLH-G----------E-GRAW-SEMAILYRTNAQSRVIEESLRRVQIPARIVG-----YDRREIRDILAYARLALNPADDVALRRIIGR--PRRGIG--DT--ALQKLMEWARTHHTSVLTACANA-A---E-QNI--------------LDRGAHKATEFAGL----MEAMSEAADNYEPAAFLRFVMETSGYLDLLR-QEG----QEGQVRLENLEELVSAAEEWS---QDEA---GSIA-----D--------F------LD-------DAA------------LLSSVDD-------------------GAPEDAVTLMTLHNAKGLEFPVVFIVGVEQGLLPSKGAIAEG-----------------------------PSG----IEEERRLFYVGITRAMERLLMTAAQNRMQF--G--K---TNAAEDSAFL-------------
26 PsiBlast_CBE 79.5533% -73 - C1 -4C2U ? D:[13-645] ---------------------------------------------------------------------------------------------------------------------------------------LNPTQAQAADHFTGPALVIAGAGSGKTRTLIYRIAHLIGHY--GVHPGEILAVTFTNKAAAEMRERAGH---LVPG----------------AGDLWMSTFHSAGVRIL----------RTYGEHIGLRRGFVIYDDDDQLDIIKEVMGSIPG---------------ETQPRVIRGI----------------------I-----------D-------------------------RAKSNL--WTPD-------------------------------DLDR-----------------SRE-----PF--------------------I------SG--LPRDAAAEAYRRYEVRKKGQNAIDFGDLITETVRLFKEV-----PGVLDKVQNKAKFIHVDEYQDTNRAQYELTRLLASR---DRNLLVVGDPDQSIYKFRGADIQNILDFQKDYPD-----AKVYMLEHNYRSSARVLEAANKLIENNTERLDKT----------LKPV--KEAGQ-P--VTF-HRATDHRAEGDYVADWLTRLH-G----------E-GRAW-SEMAILYRTNAQSRVIEESLRRVQIPARIVGGV-GFYDRREIRDILAYARLALNPADDVALRRIIGR--PRRGIG--DT--ALQKLMEWARTHHTSVLTACANA-A---E-QNI--------------LDRGAHKATEFAGL----MEAMSEAADNYEPAAFLRFVMETSGYLDLLR-QEG----QEGQVRLENLEELVSAAEEWS---QDEANVGGSIA-----D--------F------LD-------DAA------------LLSSVDDMRTKAE----N----K---GAPEDAVTLMTLHNAKGLEFPVVFIVGVEQGLLPSKGAIAEG-----------------------------PSG----IEEERRLFYVGITRAMERLLMTAAQNRMQF--G--K---TNAAEDSAFL-------------
8 PsiBlast_PDB 79.1833% -73 - C1 -4C2U ? A:[13-645] ---------------------------------------------------------------------------------------------------------------------------------------LNPTQAQAADHFTGPALVIAGAGSGKTRTLIYRIAHLIGHY--GVHPGEILAVTFTNKAAAEMRERAGH---LVPG----------------AGDLWMSTFHSAGVRIL----------RTYGEHIGLRRGFVIYDDDDQLDIIKEVMGSIPG---------------ETQPRVIRGI----------------------I-----------D-------------------------RAKSNL--WTPD-------------------------------DLDR-----------------SRE-----PF--------------------I------SG--LPRDAAAEAYRRYEVRKKGQNAIDFGDLITETVRLFKEV-----PGVLDKVQNKAKFIHVDEYQDTNRAQYELTRLLASR---DRNLLVVGDPDQSIYKFRGADIQNILDFQKDYPD-----AKVYMLEHNYRSSARVLEAANKLIENNTERLDKT----------LKPV--KEAGQ-P--VTF-HRATDHRAEGDYVADWLTRLH-G----------E-GRAW-SEMAILYRTNAQSRVIEESLRRVQIPARIVGGV-GFYDRREIRDILAYARLALNPADDVALRRIIGR--PRRGIG--DT--ALQKLMEWARTHHTSVLTACANA-A---E-QNI--------------LDRGAHKATEFAGL----MEAMSEAADNYEPAAFLRFVMETSGYLDLLR-QEG----QEGQVRLENLEELVSAAEEWS---QDEANVGGSIA-----D--------F------LD-------DAA------------LLSSVDDMRTKAE----N----K---GAPEDAVTLMTLHNAKGLEFPVVFIVGVEQGLLPSKGAIAEG-----------------------------PSG----IEEERRLFYVGITRAMERLLMTAAQNRMQF--G--K---TNAAEDSAFL-------------