@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu12370: (2016-06-19 )
MVTIKDIAKLANVSHTTVSRALNNSPYIKEHTKKKILELAEQLNYTPNVNAKSLAMQKSHTIGLFFTSITNGTSHSFFADTIKGVNQAISEDYNLYVRGIDDLKNYDSVTPMRYDGIILMSQSDIDNSFIYHIREKNIPLVVLNRDIDDRTITNILSNDKEGSQEAVEYFIQSGHQDIAIIEGIEGFKSSQQRKEGYLSALIQHHIPIKHEYSVKGQYDMESGFQAMERLLALPNPPTAVFCSNDDMAIGAMNAIFAKGLRVPDDISVIGFDDIGFSQYITPRLSTVKRPVEKISVLGAQKLLSLISEPETKAEKILENTEFMVRDSVRRLTT

Atome Classification :

(31 SA) .........10........20........30........40........50........60........70........80......-..90.-......-..100----.-----.--.--.....110----.......120.......130..-.-....140.......150...-.....160.-......170.......180.-......190..-.....200.......--210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MVTIKDIAKLANVSHTTVSRALNNSPYIKEHTKKKILELAEQLNYTPNVNAKSLAMQKSHTIGLFFTSITNGTSHSFFADTIKGVNQ-AIS-E-DYNLYV-RGID-----D-----L--K--NYDSVTPM----RYDGIILMSQSDIDNSFIYHIR-E-KNIPLVVLNRDIDDR-TITN-ILSNDKEGS-QEAVEYFIQSGHQDIAIIEG-IEGFKSSQQRK-EGYLSALIQHHIPIK--HEYSVKGQYDMESGFQAMERLLALPNPPTAVFCSNDDMAIGAMNAIFAKGLRVPDDISVIGFDDIGFSQYITPRLSTVKRPVEKISVLGAQKLLSLISEPETKAEKILENTEFMVRDSVRRLTT
24 PsiBlast_CBE 81.4632%-119 - C2 -1ZVV CCPA_BACSU B:[3-320] -VTIYDVAREASVSMATVSRVVNGNPNVKPSTRKKVLETIERLGYRPNAVARGLASKKTTTVGVIIPDISN----IFYAELARGIED-IAS-MYKYNIIL-SNSD-----QNQDKQL--H--LLNNMLGK----QVDGIIFMS-GNVTEEHVEELK-K-SPVPVVLAASIESTN-QIPS-VTIDYEQAA-FDAVQSLIDSGHKNIAFVSGTLEEPINHAKKV-KGYKRALTESGLPVR--DSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAV-AMRLLTKYMNKETVDSSIVE---------------
25 PsiBlast_CBE 80.8732%-120 - C2 -1ZVV CCPA_BACSU A:[3-320] -VTIYDVAREASVSMATVSRVVNGNPNVKPSTRKKVLETIERLGYRPNAVARGLASKKTTTVGVIIPDISN----IFYAELARGIED-IAS-MYKYNIIL-SNSD-----QNQDKQL--H--LLNNMLGK----QVDGIIFMS-GNVTEEHVEELK-K-SPVPVVLAASIESTN-QIPS-VTIDYEQAA-FDAVQSLIDSGHKNIAFVSGTLEEPINHAKKV-KGYKRALTESGLPVR--DSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAV-AMRLLTKYMNKETVDSSIVE---------------
23 PsiBlast_CBE 78.8932%-117 - C2 -1ZVV CCPA_BACSU G:[3-320] -VTIYDVAREASVSMATVSRVVNGNPNVKPSTRKKVLETIE---YRPNAVARGLASKKTTTVGVIIPDISN----IFYAELARGIED-IAS-MYKYNIIL-SNSD-----QNQDKQL--H--LLNNMLGK----QVDGIIFMS-GNVTEEHVEELK-K-SPVPVVLAASIESTN-QIPS-VTIDYEQAA-FDAVQSLIDSGHKNIAFVSGTLEEPINHAKKV-KGYKRALTESGLPVR--DSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAV-AMRLLTKYMNKETVDSSIVE---------------
13 PsiBlast_PDB 76.8531%-106 - C2 -1QP0 PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
10 PsiBlast_PDB 76.7831%-107 - C2 -1PNR PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
82 HHSearch 76.6131%-106 - C2 -1QPZ PURR_ECOLI A:[1-333] -ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEK-NCFQK-GYTLIL-GNAWN----N-----LEKQRAYLSMMAQK----RVDGLLVMCSEYPE-PLLAMLEEY-RHIPMVVMDWGEAKADFTDA-VIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVPESWIVQG--DFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADG--
1 PsiBlast_PDB 76.5331%-101 - C2 -1JH9 PURR_ECOLI A:[1-330] -ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDRGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
21 PsiBlast_CBE 76.3131%-105 - C2 -1VPW PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSMKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
14 PsiBlast_PDB 76.2831%-105 - C2 -1QP4 PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
5 PsiBlast_PDB 76.1431%-103 - C2 -1QQB PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
12 PsiBlast_PDB 76.0631%-106 - C2 -1WET PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
9 PsiBlast_PDB 76.0631%-103 - C2 -2PUD PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLEANTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
8 PsiBlast_PDB 76.0031%-103 - C2 -2PUC PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLEANTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
15 PsiBlast_PDB 75.9831%-104 - C2 -1QPZ PURR_ECOLI A:[1-330] -ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
6 PsiBlast_PDB 75.9531%-101 - C2 -2PUA PURR_ECOLI A:[1-330] -ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLEANTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
7 PsiBlast_PDB 75.8231%-105 - C2 -2PUB PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLEANTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
17 PsiBlast_PDB 75.4331%-104 - C2 -1JFT PURR_ECOLI A:[1-330] -ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDAGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
20 PsiBlast_PDB 75.2531%-104 - C2 -2PUG PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLEQNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
16 PsiBlast_PDB 75.2131%-103 - C2 -1ZAY PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
22 PsiBlast_CBE 75.2031%-101 - C2 -1JFS PURR_ECOLI A:[1-330] -ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDFGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
2 PsiBlast_PDB 75.1831%-105 - C2 -1BDH PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
4 PsiBlast_PDB 74.8731%-103 - C2 -1QQA PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
3 PsiBlast_PDB 74.4831%-104 - C2 -1QP7 PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLERNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
18 PsiBlast_PDB 73.6431%-101 - C2 -2PUE PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLEQNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
19 PsiBlast_PDB 72.8331%-100 - C2 -2PUF PURR_ECOLI A:[2-330] --TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATS----SEAAYFAEIIEAVEKNCFQ-K-GYTLILGNAWN-----N-----L--E--KQRAYLSMMAQKRVDGLLVMC-SEYPEPLLAMLE-EYRHIPMVVMDWGEAKA-DFTDAVIDNAFEGG-YMAGRYLIERGHREIGVIPG-PLEQNTGAGRL-AGFMKAMEEAMIKVP--ESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV-----
29 PsiBlast_CBE 71.0731%-110 - C2 -3OQN CCPA_BACSU A:[3-320] -ITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNAVARGLASKKTTTVGVIIPDI----SSIFYSELARGIEDIATM-Y-KYNIIL-SNSDQNMEKE-----L--H--LLNTMLGK----QVDGIVFMG-GNITDEHVAEFK-R-SPVP-IVLAASVEEQ-EETP-SVAIDYEQAIYDAVKLLVDKGHTDIAFVSG-PMAEPINRSKKLQGYKRALEEANLPFN--EQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEMALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV-AMRLLTKLMNKEPVEEHIVE---------------
26 PsiBlast_CBE 70.9831%-106 - C2 -3OQO CCPA_BACSU C:[3-320] -ITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNAVARGLASKKTTTVGVIIPDI----SSIFYSELARGIEDIATM-Y-KYNIIL-SNSDQNMEKE-----L--H--LLNTMLGK----QVDGIVFMG-GNITDEHVAEFK-R-SPVP-IVLAASVEEQ-EETP-SVAIDYEQAIYDAVKLLVDKGHTDIAFVSG-PMAEPINRSKKLQGYKRALEEANLPFN--EQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEMALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV-AMRLLTKLMNKEPVEEHIVE---------------
27 PsiBlast_CBE 70.8031%-107 - C2 -3OQO CCPA_BACSU A:[3-320] -ITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNAVARGLASKKTTTVGVIIPDI----SSIFYSELARGIEDIATM-Y-KYNIIL-SNSDQNMEKE-----L--H--LLNTMLGK----QVDGIVFMG-GNITDEHVAEFK-R-SPVP-IVLAASVEEQ-EETP-SVAIDYEQAIYDAVKLLVDKGHTDIAFVSG-PMAEPINRSKKLQGYKRALEEANLPFN--EQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEMALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV-AMRLLTKLMNKEPVEEHIVE---------------
31 PsiBlast_CBE 70.4231%-104 - C2 -3OQM CCPA_BACSU A:[3-320] -ITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNAVARGLASKKTTTVGVIIPDI----SSIFYSELARGIEDIATM-Y-KYNIIL-SNSDQNMEKE-----L--H--LLNTMLGK----QVDGIVFMG-GNITDEHVAEFK-R-SPVP-IVLAASVEEQ-EETP-SVAIDYEQAIYDAVKLLVDKGHTDIAFVSG-PMAEPINRSKKLQGYKRALEEANLPFN--EQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEMALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV-AMRLLTKLMNKEPVEEHIVE---------------
28 PsiBlast_CBE 70.0531%-103 - C2 -3OQN CCPA_BACSU C:[3-320] -ITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNAVARGLASKKTTTVGVIIPDI----SSIFYSELARGIEDIATM-Y-KYNIIL-SNSDQNMEKE-----L--H--LLNTMLGK----QVDGIVFMG-GNITDEHVAEFK-R-SPVP-IVLAASVEEQ-EETP-SVAIDYEQAIYDAVKLLVDKGHTDIAFVSG-PMAEPINRSKKLQGYKRALEEANLPFN--EQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEMALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV-AMRLLTKLMNKEPVEEHIVE---------------