@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu14670: (2016-06-23 )
MTNWTEIDEIAKKWIREAGARITQSMHESLTIETKSNPNDLVTNIDKETEKFFIDRIQETFPGHRILGEEGQGDKIHSLEGVVWIIDPIDGTMNFVHQQRNFAISIGIFENGEGKIGLIYDVVHDELYHAFSGRGAYMNETKLAPLKETVIEEAILAINATWVTENRRIDQSVLAPLVKRVRGTRSYGSAALELANVAAGRIDAYITMRLAPWDYAAGCVLLNEVGGTYTTIEGEPFTFLENHSVLAGNPSIHKTIFEEYLHARK

Atome Classification :

(28 SA) .........10........20........30........40........50........60........70-.---........80........90........100.......110.......120.......130.......140.......150.....--..160.......170.....-..-180.......190.......200.......210.......220.......230.......240.......250.......260...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTNWTEIDEIAKKWIREAGARITQSMHESLTIETKSNPNDLVTNIDKETEKFFIDRIQETFPGHRILGEE--G---QGDKIHSLEGVVWIIDPIDGTMNFVHQQRNFAISIGIFENGEGKIGLIYDVVHDELYHAFSGRGAYMNETKLAPLKETVIEEAILA--INATWVTENRRIDQSVLAPL-VK-RVRGTRSYGSAALELANVAAGRIDAYITMRLAPWDYAAGCVLLNEVGGTYTTIEGEPFTFLENHSVLAGNPSIHKTIFEEYLHARK
60 HHSearch 90.8450%-130 - C6 -5DW8 ? A:[11-266] ------LYGFAQGLIQEAGIRIKQLMEQN---------NDLVTNVDKATEDFIFDTILETYPNHQVLGEE--G---HGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIG--INPNWLT-K-PILGEIFKEI-VN-DSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPH-
22 PsiBlast_CBE 90.6150%-130 - C6 -3T0J ? D:[15-263] ----------AQGLIQEAGIRIKQLMEQNL--------NDLVTNVDKATEDFIFDTILETYPNHQVLGEE--G---HGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIG--INPNWLT--KPILGEIFKEI-VN-DSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYL----
24 PsiBlast_CBE 89.9350%-129 - C6 -3T0J ? B:[15-263] ----------AQGLIQEAGIRIKQLMEQNL------NPNDLVTNVDKATEDFIFDTILETYPNHQVLGEE--G---HGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIG--INPNWLT--KPILGEIFKEI-VN-DSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYL----
1 PsiBlast_PDB 89.6350%-126 - C6 -3T0J ? A:[15-263] ----------AQGLIQEAGIRIKQLMEQNLT------PNDLVTNVDKATEDFIFDTILETYPNHQVLGEE--G---HGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIG--INPNWLT--KPILGEIFKEI-VN-DSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYL----
23 PsiBlast_CBE 89.5750%-126 - C6 -3T0J ? C:[15-263] ----------AQGLIQEAGIRIKQLMEQNLT-------NDLVTNVDKATEDFIFDTILETYPNHQVLGEE--G---HGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIG--INPNWLT--KPILGEIFKEI-VN-DSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYL----
21 PsiBlast_CBE 89.2050%-135 - C6 -5DW8 ? B:[15-263] ----------AQGLIQEAGIRIKQLMEQN------------VTNVDKATEDFIFDTILETYPNHQVLGEE--G---HGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIG--INPNWLT--KPILGEIFKEI-VN-DSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYL----
2 PsiBlast_PDB 88.2750%-128 - C6 -5DW8 ? A:[15-263] ----------AQGLIQEAGIRIKQLMEQN---------NDLVTNVDKATEDFIFDTILETYPNHQVLGEE--G---HGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIG--INPNWLT--KPILGEIFKEI-VN-DSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYL----
25 PsiBlast_CBE 84.2534%-121 - C6 -4AS5 IMPA1_MOUSE D:[5-265] ---WQECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGEESVA---AGEKTVFTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKL-CSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIAKE------
3 PsiBlast_PDB 83.9234%-121 - C6 -4AS5 IMPA1_MOUSE A:[5-265] ---WQECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGEESVA---AGEKTVFTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKL-CSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIAKE------
26 PsiBlast_CBE 83.6534%-121 - C6 -4AS5 IMPA1_MOUSE C:[5-265] ---WQECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGEESVA---AGEKTVFTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKL-CSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIAKE------
27 PsiBlast_CBE 83.5834%-122 - C6 -4AS5 IMPA1_MOUSE B:[5-265] ---WQECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGEESVA---AGEKTVFTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKL-CSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIAKE------
62 HHSearch 83.3931%-128 - C6 -4I3Y ? A:[13-264] ----QQIDKLICSWLKQIDNVIPQLIM-EMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEE--K---SNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIIS--FNAQVM--N----LDTVQDL-FD-ASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNAN--
4 PsiBlast_PDB 81.7233%-122 - C6 -1IMA IMPA1_HUMAN A:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
7 PsiBlast_PDB 81.6333%-122 - C6 -1IMD IMPA1_HUMAN A:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
35 PsiBlast_CBE 81.6033%-125 - C6 -1AWB IMPA1_HUMAN B:[4-264] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
8 PsiBlast_PDB 81.3533%-127 - C6 -1IME IMPA1_HUMAN A:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
5 PsiBlast_PDB 81.2533%-120 - C6 -1IMB IMPA1_HUMAN A:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
29 PsiBlast_CBE 81.1933%-122 - C6 -1IME IMPA1_HUMAN B:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
30 PsiBlast_CBE 81.1533%-123 - C6 -1IMD IMPA1_HUMAN B:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
31 PsiBlast_CBE 81.0833%-121 - C6 -1IMC IMPA1_HUMAN B:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
32 PsiBlast_CBE 80.9433%-123 - C6 -1IMB IMPA1_HUMAN B:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
9 PsiBlast_PDB 80.6833%-122 - C6 -4AS4 IMPA1_HUMAN A:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
33 PsiBlast_CBE 80.4933%-124 - C6 -1IMA IMPA1_HUMAN B:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------
28 PsiBlast_CBE 80.4533%-122 - C6 -4AS4 IMPA1_HUMAN B:[5-265] ---WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVA---AGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCI-PVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKE------