@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu15020: (2016-06-23 )
MASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKKPLFSVEERCELLREVTKDIPNITVETSQGLLIDYAKRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMTNNQYSFLSSSIVKEVARYNGSVSEFVPPEVELALQQKFRQG

Atome Classification :

(61 SA) .........10........20........30........40..-......50........60........70.-.......80.....----...90........100.......110.......120.......130.......140.......150.......160
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKK-PLFSVEERCELLREVTKDIPNITVETSQG-LLIDYAKRKNAKAI----LRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMTNNQYSFLSSSIVKEVARYNGSVSEFVPPEVELALQQKFRQG
1 PsiBlast_PDB 83.9096%-136 - C2 -1O6B COAD_BACSU A:[2-161] -ASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKK-PLFSVEERCELLREVTKDIPNITVETSQG-LLIDYARRKNAKAI----LRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMANNQYSFLSSSIVKEVARYDGSVSEFVPPEVELALQQKFRQG
113 HHSearch 82.2798%-136 - C2 -1O6B COAD_BACSU A:[2-160] -ASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKK-PLFSVEERCELLREVTKDIPNITVETSQG-LLIDYARRKNAKAI----LRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMANNQYSFLSSSIVKEVARYDGSVSEFVPPEVELALQQKFRQ-
108 HHSearch 74.1348%-155 - C2 -1VLH COAD_THEMA A:[13-169] --MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHHG-LLVDYLKKHGIKVL----VRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK--
31 PsiBlast_CBE 74.0449%-163 - C2 -1VLH COAD_THEMA E:[15-169] ----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHHG-LLVDYLKKHGIKVL----VRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK--
6 PsiBlast_PDB 72.6449%-159 - C2 -1VLH COAD_THEMA A:[15-169] ----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHHG-LLVDYLKKHGIKVL----VRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK--
34 PsiBlast_CBE 72.5449%-159 - C2 -1VLH COAD_THEMA B:[15-170] ----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHHG-LLVDYLKKHGIKVL----VRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKE-
30 PsiBlast_CBE 72.1549%-163 - C2 -1VLH COAD_THEMA F:[15-169] ----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHHG-LLVDYLKKHGIKVL----VRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK--
2 PsiBlast_PDB 70.7557%-143 - C2 -3F3M COAD_STAAW A:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLK------GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
107 HHSearch 70.4646%-147 - C2 -3K9W COAD_BURP1 A:[21-179] SMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKK-PFFSLEERLKIANEVLGHYPNVKVMGFTG-LLKDFVRANDARVI----VRGLRAVSDFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVA--
112 HHSearch 69.7757%-145 - C2 -4NAT COAD_STAAW A:[2-160] EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVL-------GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
29 PsiBlast_CBE 69.4757%-136 - C2 -4NAH COAD_STAAW B:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
32 PsiBlast_CBE 69.1949%-159 - C2 -1VLH COAD_THEMA D:[15-170] ----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHHG-LLVDYLKKHGIKVL----VRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKE-
22 PsiBlast_CBE 68.8257%-140 - C2 -4NAU COAD_STAAW B:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
5 PsiBlast_PDB 68.6757%-141 - C2 -4NAU COAD_STAAW A:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
123 Fugue 68.4242%-146 * C2 *1B6T COAD_ECOLI A:[3-159] --KRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-PMFTLEERVALAQQATAHLGNVEVVGFSD-LMANFARNQHATVL----IRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA--
21 PsiBlast_CBE 68.3557%-138 - C2 -4NAU COAD_STAAW C:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
11 PsiBlast_PDB 68.3443%-135 - C2 -1GN8 COAD_ECOLI A:[1-158] MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKK-PMFTLEERVALAQQATAHLGNVEVVGFSD-LMANFARNQHATVL----IRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKL---
3 PsiBlast_PDB 68.2157%-139 - C2 -4NAH COAD_STAAW A:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
24 PsiBlast_CBE 68.0757%-141 - C2 -4NAT COAD_STAAW B:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLK----E-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
89 PsiBlast_CBE 68.0242%-145 - C2 -3OTW COAD_HELPY D:[7-156] MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFEG-LLANLAKEYHCKVL----VRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-----------
33 PsiBlast_CBE 67.8649%-161 - C2 -1VLH COAD_THEMA C:[15-170] ----AVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKK-CMFTLEERKKLIEEVLSDLDGVKVDVHHG-LLVDYLKKHGIKVL----VRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKE-
23 PsiBlast_CBE 67.7357%-143 - C2 -4NAT COAD_STAAW C:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLK------GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
28 PsiBlast_CBE 67.7257%-135 - C2 -4NAH COAD_STAAW C:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
25 PsiBlast_CBE 67.6657%-137 - C2 -4NAH COAD_STAAW F:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
4 PsiBlast_PDB 67.5257%-149 - C2 -4NAT COAD_STAAW A:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVL-------GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
27 PsiBlast_CBE 67.3857%-139 - C2 -4NAH COAD_STAAW D:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
91 PsiBlast_CBE 67.0342%-144 - C2 -3OTW COAD_HELPY B:[7-156] MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFEG-LLANLAKEYHCKVL----VRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-----------
104 HHSearch 66.9551%-144 - C2 -1OD6 COAD_THET8 A:[1-160] --MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLEN----QYLFSAEERLAIIREATAHLANVEAATFSG-LLVDFVRRVGAQAI----VKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ-
26 PsiBlast_CBE 66.5557%-127 - C2 -4NAH COAD_STAAW E:[4-160] --TIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKE-GTFSLEERMDLIEQSVKHLPNVKVHQFSG-LLVDYCEQVGAKTI----IRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK--
105 HHSearch 64.8944%-137 - C2 -4RUK ? A:[2-158] --NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFST-LLAHFVKEQKANVF----LRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK--
60 PsiBlast_CBE 64.7743%-148 - C2 -3NBK COAD_MYCTU A:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
111 HHSearch 64.6942%-144 - C2 -3NBK COAD_MYCTU A:[21-177] -MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAIVKGLRTGTD----FEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN--
90 PsiBlast_CBE 64.2542%-136 - C2 -3OTW COAD_HELPY C:[7-156] MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFEG-LLANLAKEYHCKVL----VRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-----------
88 PsiBlast_CBE 64.1342%-136 - C2 -3OTW COAD_HELPY E:[7-156] MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFEG-LLANLAKEYHCKVL----VRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-----------
92 PsiBlast_CBE 63.6842%-143 - C2 -3OTW COAD_HELPY A:[7-156] MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFEG-LLANLAKEYHCKVL----VRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-----------
59 PsiBlast_CBE 63.1943%-151 - C2 -3NBK COAD_MYCTU B:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
57 PsiBlast_CBE 62.7843%-154 - C2 -3NBK COAD_MYCTU D:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
58 PsiBlast_CBE 62.6843%-153 - C2 -3NBK COAD_MYCTU C:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
54 PsiBlast_CBE 62.5543%-148 - C2 -3PNB COAD_MYCTU C:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
73 PsiBlast_CBE 61.5843%-149 - C2 -3RHS COAD_MYCTU A:[4-156] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
87 PsiBlast_CBE 61.3842%-138 - C2 -3OTW COAD_HELPY F:[7-156] MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFEG-LLANLAKEYHCKVL----VRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-----------
72 PsiBlast_CBE 61.1943%-152 - C2 -3UC5 COAD_MYCTU A:[4-156] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
65 PsiBlast_CBE 60.9343%-152 - C2 -3LCJ COAD_MYCTU A:[4-156] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
63 PsiBlast_CBE 60.8943%-153 - C2 -3NBA COAD_MYCTU B:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
56 PsiBlast_CBE 60.7143%-150 - C2 -3PNB COAD_MYCTU A:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
49 PsiBlast_CBE 60.1445%-127 - C2 -3X1K ? C:[7-158] -------PGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFST-LLAHFVKEQKANVF----LRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK--
93 PsiBlast_CBE 60.0842%-185 - C2 -3NV7 COAD_HELPY A:[3-150] --KVGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKN-PMFSLDERLKMIQLATKSFKNVECVAFEG-LLAYLAKEYHCKVL----VRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEI-----------
53 PsiBlast_CBE 59.9443%-151 - C2 -3PNB COAD_MYCTU D:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
55 PsiBlast_CBE 59.7443%-156 - C2 -3PNB COAD_MYCTU B:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
61 PsiBlast_CBE 59.5743%-151 - C2 -3NBA COAD_MYCTU D:[24-176] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
74 PsiBlast_CBE 59.5543%-153 - C2 -3RBA COAD_MYCTU A:[4-156] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
64 PsiBlast_CBE 59.1743%-144 - C2 -4E1A COAD_MYCTU A:[4-156] ----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKT-GMFDLDERIAMVKESTTHLPNLRVQVGHG-LVVDFVRSCGMTAI----VKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL---
51 PsiBlast_CBE 58.7845%-122 - C2 -3X1J ? C:[7-158] -------PGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKN-PLFSLEQRVALAQEVTKHLPNVEVVGFST-LLAHFVKEQKANVF----LRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK--