@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu15290: (2016-06-23 )
MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRHTSQPADDTLDIPTFLRNRNKRG

Atome Classification :

(53 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......--210.........220.......230.......240.......250..-......260.......270.......280.......290.......300-.-......310.......320.......330.......340.......350.......360.......370.......380
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRHTSQPADDTLDIPTFLRNRNKRG
1 PsiBlast_PDB 91.4899%-118 - C3 -2VAM FTSZ_BACSU A:[12-315] -----------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-------------------------------------------------------------------
71 HHSearch 90.85100%-115 - C3 -2VXY FTSZ_BACSU A:[11-316] ----------LASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGFI------------------------------------------------------------------
2 PsiBlast_PDB 90.6399%-115 - C3 -2VXY FTSZ_BACSU A:[11-316] ----------LASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGFI------------------------------------------------------------------
3 PsiBlast_PDB 90.1199%-111 - C3 -2RHH FTSZ_BACSU A:[2-305] -----------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-------------------------------------------------------------------
4 PsiBlast_PDB 89.5199%-113 - C3 -2RHJ FTSZ_BACSU A:[2-307] -----------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGFLE-----------------------------------------------------------------
22 PsiBlast_CBE 89.4199%-107 - C3 -2RHL FTSZ_BACSU B:[2-307] -----------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGFLE-----------------------------------------------------------------
7 PsiBlast_PDB 89.3099%-113 - C3 -4U39 FTSZ_BACSU A:[3-304] ------------SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIA------L--D--FADVKTIM--KGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATG--------------------------------------------------------------------
5 PsiBlast_PDB 88.7999%-113 - C3 -2RHL FTSZ_BACSU A:[2-306] -----------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGFL------------------------------------------------------------------
6 PsiBlast_PDB 88.2099%-110 - C3 -2RHO FTSZ_BACSU A:[2-306] -----------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGFL------------------------------------------------------------------
21 PsiBlast_CBE 88.0999%-112 - C3 -2RHO FTSZ_BACSU B:[2-305] -----------ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINL--D--FADVKTIMSN--SALMGIGIATGENRAAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATGF-------------------------------------------------------------------
24 PsiBlast_CBE 85.5099%-105 - C3 -4U39 FTSZ_BACSU E:[3-303] ------------SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIAT-----------FADVKTIMSN--SALMGIGIA----RAAEAAKKAISSP--E-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIAT---------------------------------------------------------------------
25 PsiBlast_CBE 85.0099%-106 - C3 -4U39 FTSZ_BACSU D:[3-304] ------------SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLI-------------FADVKTIMS---SALMGIG------RAAEAAKKAISSPL---AA-ID--QGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATG--------------------------------------------------------------------
26 PsiBlast_CBE 84.7599%-110 - C3 -4U39 FTSZ_BACSU B:[3-304] ------------SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIAT-----------FADVKTIMS--GSALMGIGIAT----AAEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL-K-DEIVVTVIATG--------------------------------------------------------------------
73 HHSearch 84.1378%-102 - C3 -4M8I FTSZ_STAEQ A:[17-327] ----------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTAGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFGFEGRKRQTQAAAGVESMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGFEDKPSS-------------------------------------------------------------
23 PsiBlast_CBE 84.0399%-113 - C3 -4U39 FTSZ_BACSU G:[4-304] -------------IKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIA--------------DVKTIMS--GSALMGIGIA------AEAAKKAISSPLLE-AA-IDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENL------VVTVIATG--------------------------------------------------------------------
15 PsiBlast_PDB 83.9379%-107 - C3 -4M8I FTSZ_STAEQ A:[17-321] ----------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTAGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFGFEGRKRQTQAAAGVESMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-------------------------------------------------------------------
10 PsiBlast_PDB 83.3669%-104 - C3 -4DXD FTSZ_STAAU A:[18-324] -----------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGFDDK----------------------------------------------------------------
28 PsiBlast_CBE 83.2769%-108 - C3 -3VO8 FTSZ_STAAM B:[14-317] -----------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-------------------------------------------------------------------
12 PsiBlast_PDB 82.0869%-106 - C3 -3WGM FTSZ_STAAM A:[14-314] -----------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATG--------------------------------------------------------------------
8 PsiBlast_PDB 81.7269%-105 - C3 -3VO8 FTSZ_STAAM A:[14-318] -----------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGFD------------------------------------------------------------------
29 PsiBlast_CBE 81.5669%-104 - C3 -3WGM FTSZ_STAAM B:[14-314] -----------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATG--------------------------------------------------------------------
27 PsiBlast_CBE 80.9069%-109 - C3 -3WGN FTSZ_STAAM B:[14-317] -----------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-------------------------------------------------------------------
9 PsiBlast_PDB 80.6569%-108 - C3 -3WGN FTSZ_STAAM A:[14-317] -----------ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-------------------------------------------------------------------
30 PsiBlast_CBE 80.0669%-107 - C3 -3WGL FTSZ_STAAM B:[13-316] ----------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGFD------------------------------------------------------------------
13 PsiBlast_PDB 80.0269%-112 - C3 -3WGK FTSZ_STAAM A:[13-316] ----------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--GL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGFD------------------------------------------------------------------
11 PsiBlast_PDB 79.8369%-108 - C3 -3WGL FTSZ_STAAM A:[13-315] ----------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--NL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-------------------------------------------------------------------
31 PsiBlast_CBE 79.7169%-107 - C3 -3WGK FTSZ_STAAM B:[13-316] ----------LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGA--GL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGFD------------------------------------------------------------------
77 HHSearch 78.6556%-117 * C3 *1OFU FTSZ_PSEAE A:[11-317] ----------TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVN-LQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGLG------------------------------------------------------------------
74 HHSearch 78.5363%-115 - C3 -1RQ2 FTSZ_MYCTU A:[11-315] ----------LAVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDST-----GADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-AS-MEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-------------------------------------------------------------------
40 PsiBlast_CBE 78.1656%-116 - C3 -1OFU FTSZ_PSEAE B:[11-316] ----------TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLE-DVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-------------------------------------------------------------------
41 PsiBlast_CBE 78.0956%-117 - C3 -1OFU FTSZ_PSEAE A:[11-316] ----------TAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLE-DVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-------------------------------------------------------------------
76 HHSearch 77.5347%-120 - C3 -2VAP FTSZ1_METJA A:[32-347] -----YLQQTKAKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVP-NMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VD-IDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITGVQSRIEFT------------------------------------------------------------
16 PsiBlast_PDB 77.4680%-101 - C3 -3VOA FTSZ_STAAM A:[21-307] ----------------------------RMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-------------------------------------------------------------------
17 PsiBlast_PDB 77.3880% -99 - C3 -3VOB FTSZ_STAAM A:[21-307] ----------------------------RMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNL--D--FADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLE-TS-IVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPEL-Q-DEIVVTVIATGF-------------------------------------------------------------------
55 PsiBlast_CBE 77.1149%-122 - C3 -1W5B FTSZ1_METJA A:[38-339] -----------AKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VD-IDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG--------------------------------------------------------------------
53 PsiBlast_CBE 76.9549%-124 - C3 -2VAP FTSZ1_METJA A:[38-339] -----------AKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VD-IDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG--------------------------------------------------------------------
57 PsiBlast_CBE 76.3349%-117 - C3 -1W5A FTSZ1_METJA A:[38-339] -----------AKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VD-IDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG--------------------------------------------------------------------
72 HHSearch 76.2355%-111 - C3 -2VAW FTSZ_PSEAE A:[2-316] -FELVDNIAQTAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINV--D--FADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPLLEDVN-LQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADM-R-DELHVTVVATGL-------------------------------------------------------------------
56 PsiBlast_CBE 75.8549%-120 - C3 -1W5A FTSZ1_METJA B:[38-339] -----------AKITVVGCGGAGNNTITRLKMEGIEGAKTVAINTDAQQLIRTKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIV-PNMPLKLAFKVADEVLINAVKGLVELITKDGLINV--D--FADVKAVMNNGGLAMIGIGESDSEKRAKEAVSMALNSPLLD-VD-IDGATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENL-E-NTVRVLLVITG--------------------------------------------------------------------
34 PsiBlast_CBE 75.1259%-119 - C3 -4KWE FTSZ_MYCTU B:[25-315] ------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVG----------ADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-AS-MEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSL-G-DEVRVTVIAAGF-------------------------------------------------------------------
33 PsiBlast_CBE 75.0259%-120 - C3 -4KWE FTSZ_MYCTU C:[25-315] ------------------------NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVG----------ADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTPGLINV--D--FADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLLE-AS-MEGAQGV