@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu15540: (2016-06-24 )
MLEVKLPGLDLKNPIIPASGCFGFGKEFSRFYDLSCLGAIMIKATTKEPRFGNPTPRVAETGAGMLNAIGLQNPGLDSVLHHELPWLEQFDTPIIANVAGSQVDDYVEVAEHISKAPNVHALELNISCPNVKTGGIAFGTNPEMAADLTKAVKEVSDVPVYVKLSPNVANITEIALAIEEAGADGLTMINTLIGMRLDLKTGKPILANKTGGLSGPAVKPVAIRMVYEVSQMVNIPIIGMGGVQTAEDALEFLLAGASAVAVGTANFVNPFACPEIIEQLPSVLLQYGYQSIEECIGRSWNHEKQPAHHRA

Atome Classification :

(23 SA) -----.........10........20.-.......30........40.....--...-50........60-.----------........70........80......-.--.----90-..-------.......100.-.-----......110...-.-.-.---.-120.......130-.-...-...140.......150..------.....160......--.--170.......180........190----.-.-.-....200...--.------...210.........220---.......230.--.--.....240.......250.......260...-...-.-270.......280.......290.......300.......310
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----MLEVKLPGLDLKNPIIPASGCF-GFGKEFSRFYDLSCLGAIMIKATT--KEP-RFGNPTPRVAE--T----------GAGMLNAIGLQNPGLDSVLHHELPWL-E--Q----F--DT-------PIIANVAGS-Q-V-----DDYVEVAEHISK-A-P-N---V-HALELNISCPNVK-T-GGI-AFGTNPEMAADLTKAVKE------VSDVPVYVKLSPNV--A--NITEIALAIEE-AGADGLTMINTL----I-G-M-RLDLKTGKPI--L------ANKT--GGLSGPAVKPVA---IRMVYEVSQMV--N--IPIIGMGGVQTAEDALEFLLAGASAVAVGTA-NFV-N-PFACPEIIEQLPSVLLQYGYQSIEECIGRSWNHEKQPAHHRA
1 PsiBlast_PDB 93.5168%-131 - C1 -1EP1 PYRDB_LACLM A:[7-303] ------LSVKLPGLDLKNPIIPASGCF-GFGEEYAKYYDLNKLGSIMVKATT--LHP-RFGNPTPRVAE--T----------ASGMLNAIGLQNPGLEVIMTEKLPWLNE--N----FP-EL-------PIIANVAGS-E-E-----ADYVAVCAKIGD-A-A-N---V-KAIELNISCPNVK-H-GGQ-AFGTDPEVAAALVKACKA------VSKVPLYVKLSPNV--T--DIVPIAKAVEA-AGADGLTMINTL----M-G-V-RFDLKTRQPI--L------ANIT--GGLSGPAIKPVA---LKLIHQVAQDV--D--IPIIGMGGVANAQDVLEMYMAGASAVAVGTA-NFA-D-PFVCPKIIDKLPELMDQYRIESLESLI---------------
2 PsiBlast_PDB 93.3568%-129 - C1 -1EP2 PYRDB_LACLM A:[7-303] ------LSVKLPGLDLKNPIIPASGCF-GFGEEYAKYYDLNKLGSIMVKATT--LHP-RFGNPTPRVAE--T----------ASGMLNAIGLQNPGLEVIMTEKLPWLNE--N----FP-EL-------PIIANVAGS-E-E-----ADYVAVCAKIGD-A-A-N---V-KAIELNISCPN------GQ-AFGTDPEVAAALVKACKA------VSKVPLYVKLSPNV--T--DIVPIAKAVEA-AGADGLTMINTL----M-G-V-RFDLKTRQPI--L------ANIT--GGLSGPAIKPVA---LKLIHQVAQDV--D--IPIIGMGGVANAQDVLEMYMAGASAVAVGTA-NFA-D-PFVCPKIIDKLPELMDQYRIESLESLI---------------
59 Fugue 91.5267%-128 - C1 -1EP3 PYRDB_LACLM A:[1-311] MTENNRLSVKLPGLDLKNPIIPASG-CFGFGEEYAKYYDLNKLGSIMVKATTLH--P-RFGNPTPRVAETA------------SGMLNAIGLQNPGLEVIMTEKLPWL-N--ENFPE----L-------PIIANVAGS--EE-----ADYVAVCAKIGD-A-A-N---V-KAIELNISCPNVK-HG-GQ-AFGTDPEVAAALVKACKA------VSKVPLYVKLSPNVT----DIVPIAKAVEA-AGADGLTMINTL----M--GV-RFDLKTRQPI--LAN------IT--GGLSGPAIKPVA---LKLIHQVAQDV---D-IPIIGMGGVANAQDVLEMYMAGASAVAVGTA-NFA--DPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK-------
3 PsiBlast_PDB 90.4468%-125 - C1 -1EP3 PYRDB_LACLM A:[7-303] ------LSVKLPGLDLKNPIIPASGCF-GFGEEYAKYYDLNKLGSIMVKATT--LHP-RFGNPTPRVAE--T----------ASGMLNAIGLQNPGLEVIMTEKLPWLNE--N----FP-EL-------PIIANVAGS-E-E-----ADYVAVCAKIGD-A-A-N---V-KAIELNISCPNVK-H-GGQ-AFGTDPEVAAALVKACKA------VSKVPLYVKLSPNV--T--DIVPIAKAVEA-AGADGLTMINTL----M-G-V-RFDLKTRQPI--L------ANIT--GGLSGPAIKPVA---LKLIHQVAQDV--D--IPIIGMGGVANAQDVLEMYMAGASAVAVGTA-NFA-D-PFVCPKIIDKLPELMDQYRIESLESLI---------------
37 HHSearch 90.2367%-122 * C1 *1EP3 PYRDB_LACLM A:[6-309] -----RLSVKLPGLDLKNPIIPASGCF-GFGEEYAKYYDLNKLGSIMVKATT--LHP-RFGNPTPRVAE--T----------ASGMLNAIGLQNPGLEVIMTEKLPWL-NENF----P--EL-------PIIANVAGS-E-E-----ADYVAVCAKIGDAA---N---V-KAIELNISCPNVK-H-GGQ-AFGTDPEVAAALVKACKA------VSKVPLYVKLSPNV--T--DIVPIAKAVEA-AGADGLTMINTL----M-G-V-RFDLKTRQPI--L------ANIT--GGLSGPAIKPVA---LKLIHQVAQDV--D--IPIIGMGGVANAQDVLEMYMAGASAVAVGTA-NFA-D-PFVCPKIIDKLPELMDQYRIESLESLIQEVKEG---------
41 HHSearch 67.8330%-112 - C1 -4EF8 ? A:[36-346] -----SLQVNLLNNTFANPFMNAAGVM-CTTTEELVAMTESASGSLVSKSCT--PAL-REGNPTPRYQA--L----------PLGSINSMGLPNNGFDFYLAYAAEQH-D--Y----G--KK-------PLFLSMSGL-S-M-----RENVEMCKRLAA-V---ATEKG-VILELNLSCPNVP-G--KP-QVAYDFDAMRQCLTAVSE------VYPHSFGVKMPPYFDFA--HFDAAAEILNEFPKVQFITCINSI----GNG-L-VIDAETESVV--IKP----KQGF--GGLGGRYVLPTA---LANINAFYRRCP-G--KLIFGCGGVYTGEDAFLHVLAGASMVQVGTA-LQEEG-PSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL---------
40 HHSearch 64.3729%-109 - C1 -2E6F PYRD_TRYCC A:[3-313] -----CLKLNLLDHVFANPFMNAAGVL-CSTEEDLRCMTASSSGALVSKSCT--SAP-RDGNPEPRYMA--F----------PLGSINSMGLPNLGFDFYLKYASDLH-D--Y----S--KK-------PLFLSISGL-S-V-----EENVAMVRRLAP-VAQEK---G-VLLELNLSCPNVP-G--KP-QVAYDFEAMRTYLQQVSL------AYGLPFGVKMPPYFDIA--HFDTAAAVLNEFPLVKFVTCVNSV----GNG-L-VIDAESESVV--IKP----KQGF--GGLGGKYILPTA---LANVNAFYRRCP-D--KLVFGCGGVYSGEDAFLHILAGASMVQVGTA-LQEEG-PGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI---------
58 Fugue 61.6829%-104 - C1 -2DOR PYRDA_LACLM A:[1-311] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--E----NAQEG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNVP---GKP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYFDLV--HFDIMAEILNQ-FPLTYVNSVNSI----G-NGL-FIDPEAESVV--IKP----KDGF--GGIGGAYIKPTA---LANVRAFYTRLKPE--IQIIGTGGIETGQDAFEHLLCGATMLQIGTA-LHKEG-PAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL---------
12 PsiBlast_PDB 60.8630%-103 - C1 -2BSL PYRDA_LACLM A:[1-307] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--ENA--Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNV--P-GKP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYF-----DLVHFDIMAEI-LNQFPLTYVNSVNSIGN-G-L-FIDPEAESVV--I------KPKDGFGGIGGAYIKPTA---LANVRAFYTRL--KPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKE-G-PAIFDRIIKELEEIMNQKGYQSIADFHGK-------------
11 PsiBlast_PDB 60.7430%-102 - C1 -1JUE PYRDA_LACLM A:[1-307] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--ENA--Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNV--P-GKP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYF-----DLVHFDIMAEI-LNQFPLTYVNSVNSIGN-G-L-FIDPEAESVV--I------KPKDGFGGIGGAYIKPTA---LANVRAFYTRL--KPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKE-G-PAIFDRIIKELEEIMNQKGYQSIADFHGK-------------
13 PsiBlast_PDB 60.5430%-104 - C1 -2BX7 PYRDA_LACLM A:[1-307] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--ENA--Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNV--P-GKP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYF-----DLVHFDIMAEI-LNQFPLTYVNSVNSIGN-G-L-FIDPEAESVV--I------KPKDGFGGIGGAYIKPTA---LANVRAFYTRL--KPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKE-G-PAIFDRIIKELEEIMNQKGYQSIADFHGK-------------
10 PsiBlast_PDB 60.3830%-101 - C1 -2DOR PYRDA_LACLM A:[1-307] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--ENA--Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNV--P-GKP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYF-----DLVHFDIMAEI-LNQFPLTYVNSVNSIGN-G-L-FIDPEAESVV--I------KPKDGFGGIGGAYIKPTA---LANVRAFYTRL--KPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKE-G-PAIFDRIIKELEEIMNQKGYQSIADFHGK-------------
14 PsiBlast_PDB 59.7030%-104 - C1 -1JUB PYRDA_LACLM A:[1-307] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--ENA--Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNV--P-GEP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYF-----DLVHFDIMAEI-LNQFPLTYVNSVNSIGN-G-L-FIDPEAESVV--I------KPKDGFGGIGGAYIKPTA---LANVRAFYTRL--KPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKE-G-PAIFDRIIKELEEIMNQKGYQSIADFHGK-------------
9 PsiBlast_PDB 59.5530%-102 - C1 -1DOR PYRDA_LACLM A:[1-307] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--ENA--Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNV--P-GKP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYF-----DLVHFDIMAEI-LNQFPLTYVNSVNSIGN-G-L-FIDPEAESVV--I------KPKDGFGGIGGAYIKPTA---LANVRAFYTRL--KPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKE-G-PAIFDRIIKELEEIMNQKGYQSIADFHGK-------------
15 PsiBlast_PDB 59.5230%-103 - C1 -1OVD PYRDA_LACLM A:[1-307] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-K--ENA--Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S-D-F---S-GITELNLSCPNV--P-GEP-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYF-----DLVHFDIMAEI-LNQFPLTYVNSVNSIGN-G-L-FIDPEAESVV--I------KPKDGFGGIGGAYIKPTA---LANVRAFYTRL--KPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKE-G-PAIFDRIIKELEEIMNQKGYQSIADFHGK-------------
42 HHSearch 58.9430%-106 - C1 -1JUB PYRDA_LACLM A:[1-309] -----MLNTTFANAKFANPFMNASGVH-CMTIEDLEELKASQAGAYITKSST--LEK-REGNPLPRYVD--L----------ELGSINSMGLPNLGFDYYLDYVLKNQ-KENA----Q--EG-------PIFFSIAGM-S-A-----AENIAMLKKIQE-S---D---FSGITELNLSCPNVP-G-E-P-QLAYDFEATEKLLKEVFT------FFTKPLGVKLPPYFDLV--HFDIMAEILNQ-FPLTYVNSVNSIG---N-G-L-FIDPEAESVVIKP------KDGF--GGIGGAYIKPTA---LANVRAFYTRLKPE--IQIIGTGGIETGQDAFEHLLCGATMLQIGTA-LHKEG-PAIFDRIIKELEEIMNQKGYQSIADFHGKLK-----------
17 PsiBlast_PDB 58.8330% -92 - C1 -3KVK PYRD_HUMAN A:[72-385] -----MLEVRVLGHKFRNPVGIAAGFD-KHGEAVDGLYKMG-FGFVEIGSVT--PKP-QEGNPRPRVFRLPE----------DQAVINRYGFNSHGL-SVVEHRLRAR-Q--Q----K--QAKLTEDGLPLGVNLGKN-K-TSVDAAEDYAEGVRVL---G-P-L---A-DYLVVNVSSPN---T-AGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDL--TSQDKEDIASVVKE-LGIDGLIVTNTT----V-S-R-PAGLQGA-----L------RSET--GGLSGKPLRDLSTQTIREMYALTQG---R--VPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFW-G-PPVVGKVKRELEALLKEQGFGGVTDAIG--------------
19 PsiBlast_PDB 58.0630% -90 - C1 -3KVM PYRD_HUMAN A:[72-385] -----MLEVRVLGHKFRNPVGIAAGFD-KHGEAVDGLYKMG-FGFVEIGSVT--PKP-QEGNPRPRVFRLPE----------DQAVINRYGFNSHGL-SVVEHRLRAR-Q--Q----K--QAKLTEDGLPLGVNLGKN-K-TSVDAAEDYAEGVRVL---G-P-L---A-DYLVVNVSSPN---T-AGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDL--TSQDKEDIASVVKE-LGIDGLIVTNTT----V-S-R-PAGLQGA-----L------RSET--GGLSGKPLRDLSTQTIREMYALTQG---R--VPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFW-G-PPVVGKVKRELEALLKEQGFGGVTDAIG--------------
47 HHSearch 57.6328%-112 - C1 -1GTE DPYD_PIG A:[532-857] -----DISVEMAGLKFINPFGLASAAP-TTSSSMIRRAFEAGWGFALTKTFS--LDKDIVTNVSPRIVR--GTTSGPMYGPGQSSFLNIELISEKTAAYWCQSVTELK-AD-F----P--DN-------IVIASIMCSYN-K-----NDWMELSRKAEA-S---G---A-DALELNLSCPHGMG----L-ACGQDPELVRNICRWVRQ------AVQIPFFAKLTPNV--T--DIVSIARAAKE-GGADGVTATNTV----S-G-LMGLKADG-TPW--PAVGAGKRTTY--GGVSGTAIRPIA---LRAVTTIARALP-G--FPILATGGIDSAESGLQFLHSGASVLQVCSA-VQN-QDFTVIQDYCTGLKALLYLKSIEELQGWDG--------------
16 PsiBlast_PDB 57.5930% -89 - C1 -3KVJ PYRD_HUMAN A:[72-385] -----MLEVRVLGHKFRNPVGIAAGFD-KHGEAVDGLYKMG-FGFVEIGSVT--PKP-QEGNPRPRVFRLPE----------DQAVINRYGFNSHGL-SVVEHRLRAR-Q--Q----K--QAKLTEDGLPLGVNLGKN-K-TSVDAAEDYAEGVRVL---G-P-L---A-DYLVVNVSSPN---T-AGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDL--TSQDKEDIASVVKE-LGIDGLIVTNTT----V-S-R-PAGLQGA-----L------RSET--GGLSGKPLRDLSTQTIREMYALTQG---R--VPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFW-G-PPVVGKVKRELEALLKEQGFGGVTDAIG--------------
8 PsiBlast_PDB 57.5030%-101 - C1 -4OQV PYRD_HUMAN A:[46-363] -----MLEVRVLGHKFRNPVGIAAGFD-KHGEAVDGLYKMG-FGFVEIGSVT--PKP-QEGNPRPRVFRLPE----------DQAVINRYGFNSHGL-SVVEHRLRAR-Q--Q----K--QAKLTEDGLPLGVNLGKN-K-TSVDAAEDYAEGVRVL---G-P-L---A-DYLVVNVSSP-------------GKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDL--TSQDKEDIASVVKE-LGIDGLIVTNTT----V-S-R-PAGLQGA-----L------RSET--GGLSGKPLRDLSTQTIREMYALTQG---R--VPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFW-G-PPVVGKVKRELEALLKEQGFGGVTDAIGADHR----------
18 PsiBlast_PDB 57.3430% -88 - C1 -3KVL PYRD_HUMAN A:[72-385] -----MLEVRVLGHKFRNPVGIAAGFD-KHGEAVDGLYKMG-FGFVEIGSVT--PKP-QEGNPRPRVFRLPE----------DQAVINRYGFNSHGL-SVVEHRLRAR-Q--Q----K--QAKLTEDGLPLGVNLGKN-K-TSVDAAE