@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu15720: (2016-06-24 )
MAVKKVVTHPAEVLETPAETVTVFDKKLKKLLDDMYDTMLEMDGVGLAAPQIGILKRAAVVEIGDDRGRIDLVNPEILEKSGEQTGIEGCLSFPNVYGDVTRADYVKVRAFNRQGKPFILEARGFLARAVQHEMDHLDGVLFTSKISKYYTEDELADMEG

Atome Classification :

(95 SA) .........10........20..---.-----.....30........40........50......----..60--..---...-------.--------.------.---70......--..80.-----.-.-..-.-.-.90........100.......110.......120.......130.......140.......150.......160----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAVKKVVTHPAEVLETPAETVTV---F-----DKKLKKLLDDMYDTMLEMDGVGLAAPQIGILKR----AAVV--EI---GDD-------R--------G------R---IDLVNPEI--LEKSG-----E-Q-TG-I-E-GCLSFPNVYGDVTRADYVKVRAFNRQGKPFILEARGFLARAVQHEMDHLDGVLFTSKISKYYTEDELADMEG------
110 HHSearch 93.6967% -89 - C5 -1WS0 DEF1_BACCR A:[1-151] MAVLEIIKHPNEVLETPCERVIN---F-----DKKLVKLLKDMHETMLIADGVGLAAPQVGVSLQ----VAVV--DV---DDD-------T--------G------K---IELINPSI--LEKRG-----E-Q-VG-P-E-GCLSFPGLYGEVERADYIKVRAQNRRGKVFLLEAEGFLARAIQHEIDHLHGVLFTSKVTRYYE---------------
1 PsiBlast_PDB 93.6967% -89 - C5 -1WS0 DEF1_BACCR A:[1-151] MAVLEIIKHPNEVLETPCERVIN---F-----DKKLVKLLKDMHETMLIADGVGLAAPQVGVSLQ----VAVV--DV---DDD-------T--------G------K---IELINPSI--LEKRG-----E-Q-VG-P-E-GCLSFPGLYGEVERADYIKVRAQNRRGKVFLLEAEGFLARAIQHEIDHLHGVLFTSKVTRYYE---------------
2 PsiBlast_PDB 92.2267% -90 - C5 -1WS1 DEF1_BACCR A:[1-151] MAVLEIIKHPNEVLETPCERVIN---F-----DKKLVKLLKDMHETMLIADGVGLAAPQVGVSLQ----VAVV--DV---DDD-------T--------G------K---IELINPSI--LEKRG-----E-Q-VG-P-E-GCLSFPGLYGEVERADYIKVRAQNRRGKVFLLEAEGFLARAIQHEIDHLHGVLFTSKVTRYYE---------------
61 PsiBlast_CBE 86.7145%-112 - C5 -4WXK DEF_HAEI8 A:[3-148] --ALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
60 PsiBlast_CBE 86.6845%-107 - C5 -4WXK DEF_HAEI8 B:[3-148] --ALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
57 PsiBlast_CBE 85.9945%-111 - C5 -4WXL DEF_HAEI8 A:[3-148] --ALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
58 PsiBlast_CBE 85.9445%-108 - C5 -4WXK DEF_HAEI8 D:[2-148] -TALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
54 PsiBlast_CBE 85.7945%-110 - C5 -4WXL DEF_HAEI8 D:[3-148] --ALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
55 PsiBlast_CBE 85.4745%-108 - C5 -4WXL DEF_HAEI8 C:[2-148] -TALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
59 PsiBlast_CBE 84.8445%-107 - C5 -4WXK DEF_HAEI8 C:[1-148] MTALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
56 PsiBlast_CBE 84.5745%-111 - C5 -4WXL DEF_HAEI8 B:[5-148] ----NVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DVE--GDK-------Q--------N------Q---FVLINPEI--LASEG-----E---TG-I-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLS-------------------
23 PsiBlast_CBE 83.3547%-109 - C5 -4AL2 DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
44 PsiBlast_CBE 83.1347% -95 - C5 -1BS7 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
24 PsiBlast_CBE 82.9847% -98 - C5 -4AL2 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
32 PsiBlast_CBE 82.9547% -94 - C5 -1LRU DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
48 PsiBlast_CBE 82.6747% -95 - C5 -1BS5 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
46 PsiBlast_CBE 82.5847% -95 - C5 -1BS6 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
63 PsiBlast_CBE 82.5739% -95 - C5 -4E9A ? A:[1-152] -ALLEIIHYPSKILRTISKEVVS---F-----DAKLHQQLDDMYETMIASEGIGLAAIQVGLPLR----MLII--NL---PQE-------D--------GVQHKEDC---LEIINPKF--IETGG-----S-M-MY-K-E-GCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLEASELLAVAIQHEIDHLNGVLFVDKLS-------------------
12 PsiBlast_PDB 82.4947%-101 - C5 -1BS6 DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
79 PsiBlast_CBE 82.4340% -84 - C5 -1N5N DEF_PSEAE B:[14-161] -AILNILEFPDPRLRTIAKPVEV---V-----DDAVRQLIDDMFETMYEAPGIGLAATQVNVHKR----IVVM--DL---SED-------K--------SEP----R---V-FINPEF--EPLTE-----E-M-DQ-YQE-GCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLS-------------------
112 HHSearch 82.1441% -97 - C5 -4WXK DEF_HAEI8 A:[3-157] --ALNVLIYPDDHLKVVCEPVTE---V-----NDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQR----IITI--DV---EGD-------KQ-------N------Q---FVLINPEI--LASEG-----E-T-GI-E-E-GCLSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKE----------
9 PsiBlast_PDB 82.1147% -93 - C5 -1ICJ DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
15 PsiBlast_PDB 81.7947% -92 - C5 -1BSZ DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
26 PsiBlast_CBE 81.7647% -92 - C5 -2AI8 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
14 PsiBlast_PDB 81.6647%-101 - C5 -1BS8 DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
10 PsiBlast_PDB 81.6647% -91 - C5 -1BS4 DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
42 PsiBlast_CBE 81.3847% -96 - C5 -1BS8 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
20 PsiBlast_PDB 81.3347% -94 - C5 -1LRU DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
3 PsiBlast_PDB 81.1948% -99 - C5 -3K6L DEF_ECOLI A:[2-148] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
27 PsiBlast_CBE 81.1847% -91 - C5 -2AI8 DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
39 PsiBlast_CBE 81.1547% -95 - C5 -1BSZ DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
19 PsiBlast_PDB 81.1447% -99 - C5 -1G2A DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
45 PsiBlast_CBE 81.1247% -96 - C5 -1BS6 DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
40 PsiBlast_CBE 81.0747% -96 - C5 -1BSZ DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
7 PsiBlast_PDB 81.0247% -95 - C5 -2W3U DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
77 PsiBlast_CBE 80.9840% -89 - C5 -1S17 DEF_PSEAE B:[14-161] -AILNILEFPDPRLRTIAKPVEV---V-----DDAVRQLIDDMFETMYEAPGIGLAATQVNVHKR----IVVM--DL---SED-------K--------SEP----R---V-FINPEF--EPLTE-----E-M-DQ-YQE-GCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLS-------------------
114 HHSearch 80.8137%-111 - C5 -3U04 ? A:[3-178] MSVLSIVTVPDKRLSLCSEEVEK---V-----DQSIRKLVDDMFETMHANQGLGLAAVQVGVHKR----ILVM--NV---PEEIEGYELYG--------G------P---YCIINPKI--VDISQ-----E-KVKL-K-E-GCLSVPGYFDYIVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVFLKYLSKFKRDFAI-----------
37 PsiBlast_CBE 80.6247% -92 - C5 -1G27 DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
41 PsiBlast_CBE 80.5747% -94 - C5 -1BS8 DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
35 PsiBlast_CBE 80.4947% -97 - C5 -1G2A DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
65 PsiBlast_CBE 80.4739% -94 - C5 -2EW6 ? A:[1-152] -ALLEIIHYPSKILRTISKEVVS---F-----DAKLHQQLDDMYETMIASEGIGLAAIQVGLPLR----MLII--NL---PQE-------D--------GVQHKEDC---LEIINPKF--IETGG-----S-M-MY-K-E-GCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLEASELLAVAIQHEIDHLNGVLFVDKLS-------------------
102 Fugue 80.4442% -95 - C5 -1G2A DEF_ECOLI A:[1-164] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------D------ER--LVLINPEL--LEKSG-----E-T-GI-E-E-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRL--
25 PsiBlast_CBE 80.4347% -93 - C5 -2AI8 DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
122 HHSearch 80.3838% -88 - C5 -4E9A ? A:[1-160] -ALLEIIHYPSKILRTISKEVVS---F-----DAKLHQQLDDMYETMIASEGIGLAAIQVGLPLR----MLII--NL---PQE-------DGVQHKE--D------C---LEIINPKF--IETGG-----S-M-MY-K-E-GCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLEASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFE-----------
17 PsiBlast_PDB 80.3647% -94 - C5 -1BSK DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
29 PsiBlast_CBE 80.3547% -93 - C5 -1XEN DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
66 PsiBlast_CBE 80.3339% -97 - C5 -2EW5 ? A:[1-152] -ALLEIIHYPSKILRTISKEVVS---F-----DAKLHQQLDDMYETMIASEGIGLAAIQVGLPLR----MLII--NL---PQE-------D--------GVQHKEDC---LEIINPKF--IETGG-----S-M-MY-K-E-GCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLEASELLAVAIQHEIDHLNGVLFVDKLS-------------------
62 PsiBlast_CBE 80.2639% -96 - C5 -4E9B ? A:[1-152] -ALLEIIHYPSKILRTISKEVVS---F-----DAKLHQQLDDMYETMIASEGIGLAAIQVGLPLR----MLII--NL---PQE-------D--------GVQHKEDC---LEIINPKF--IETGG-----S-M-MY-K-E-GCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLEASELLAVAIQHEIDHLNGVLFVDKLS-------------------
16 PsiBlast_PDB 80.2647% -94 - C5 -1BSJ DEF_ECOLI A:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
49 PsiBlast_CBE 80.2347% -97 - C5 -1BS4 DEF_ECOLI C:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
38 PsiBlast_CBE 80.1947% -96 - C5 -1G27 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
34 PsiBlast_CBE 80.1447% -96 - C5 -1ICJ DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
89 PsiBlast_CBE 80.1033%-118 - C5 -3U04 ? A:[3-172] MSVLSIVTVPDKRLSLCSEEVEK---V-----DQSIRKLVDDMFETMHANQGLGLAAVQVGVHKR----ILVM--NV---PEE--------IEGYELYGG------P---YCIINPKI--VDISQ-----E-K-VK-LKE-GCLSVPGYFDYIVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVFLKYLSKF-----------------
22 PsiBlast_CBE 80.0448% -98 - C5 -3K6L DEF_ECOLI B:[2-148] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------
50 PsiBlast_CBE 79.9947% -97 - C5 -1BS4 DEF_ECOLI B:[1-147] -SVLQVLHIPDERLRKVAKPVEE---V-----NAEIQRIVDDMFETMYAEEGIGLAATQVDIHQR----IIVI--DV---SEN-------R--------DE-----R---LVLINPEL--LEKSG-----E---TG-IEE-GCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS-------------------