@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu15980: (2016-06-25 )
MAFEGLADRLQQTISKIRGKGKVSEQDVKEMMREVRLALLEADVNFKVVKDFVKKVSERAVGQDVMKSLTPGQQVIKVVQEELTELMGGEESKIAVAKRPPTVIMMVGLQGAGKTTTSGKLANLLRKKHNRKPMLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIEKAKEEHYDYVILDTAGRLHIDHELMDELTNVKEIANPEEIFLVVDSMTGQDAVNVAKSFNEQLGLTGVVLTKLDGDTRGGAALSIRAVTNTPIKFAGLGEKLDALEPFHPERMASRILGMGDVLTLIEKAQASVDEDKAKELEQKMRTMSFTLDDFLEQLGQVRNMGPLDELLQMMPGAGKMKGLKNIQVDEKQLNHVEAIIKSMTVLEKEQPDIINASRRKRIAKGSGTSVQEVNRLLKQFDEMKKMMKQMTNMSKGKKKGFKLPFM

Atome Classification :

(34 SA) .........10........20........30........40........50........60........70........80........90..-------......100.......110.......120.....-..130.......140.......150.......160.......170.......180.......190.......200.......210----..---.------.------...---..220.......230.......240.......250.......260.......270.......280.......290.......300.......310....-...--320.....-.-.330.......340.......350.......360-.........370.......380.......390.......400.......410.......420.......430.......440....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAFEGLADRLQQTISKIRGKGKVSEQDVKEMMREVRLALLEADVNFKVVKDFVKKVSERAVGQDVMKSLTPGQQVIKVVQEELTELMGGEESK-------IAVAKRPPTVIMMVGLQGAGKTTTSGKLANLLRK-KHNRKPMLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIEKAKEEHYDYVILDTAGRLHIDHELMDELTNVK------EI---A------N------PEE---IFLVVDSMTGQDAVNVAKSFNEQLGLTGVVLTKLDGDTRGGAALSIRAVTNTPIKFAGLGEKLDALEPFHPERMASRILGMGDVLTLIEKAQASVDEDK-AKE--LEQKMRTM-S-FTLDDFLEQLGQVRNMGPLDELLQMMPGAGKM---KGLKNIQVDEKQLNHVEAIIKSMTVLEKEQPDIINASRRKRIAKGSGTSVQEVNRLLKQFDEMKKMMKQMTNMSKGKKKGFKLPFM
21 PsiBlast_CBE 87.7954%-106 - C8 -2XXA SRP54_ECOLI C:[7-425] -------DRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNELVAAMGEENQT-------LNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLRE-KHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVH------AS---I------N------PVE---TLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQ-AEK--LASKLKKGDG-FDLNDFLEQLRQMKNMGGMASLMG-------------------DDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQR---------------------
1 PsiBlast_PDB 87.0054% -99 - C8 -2XXA SRP54_ECOLI A:[4-425] ----NLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNELVAAMGEENQT-------LNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLRE-KHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVH------AS---I------N------PVE---TLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQ-AEK--LASKLKKGDG-FDLNDFLEQLRQMKNMGGMASLMGK------------------DDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQR---------------------
40 PsiBlast_CBE 81.1639%-108 - C8 -3DM5 SRP54_PYRFU A:[1-430] MVLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVYEELTKFLGTEAKP-------IEI-KEKPTILLMVGIQGSGKTTTVAKLARYFQK-R-GYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQIS------NV---I------H------PHE---VILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVE-IKEEDIERFLRG--K-FTLKDMYAQLEAMRKMGP----------------------ISIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSMN---------------
39 PsiBlast_CBE 81.0539%-111 - C8 -3DM5 SRP54_PYRFU B:[1-430] MVLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVYEELTKFLGTEAKP-------IEI-KEKPTILLMVGIQGSGKTTTVAKLARYFQK-R-GYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIE-MKQIS------NV---I------H------PHE---VILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVE-IKEEDIERFLRG--K-FTLKDMYAQLEAMRKMGP-----------------------SIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSMN---------------
81 HHSearch 80.7738%-105 - C8 -3DM5 SRP54_PYRFU A:[1-435] MVLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVYEELTKFLGTEAKP-------IEI-KEKPTILLMVGIQGSGKTTTVAKLARYFQK-R-GYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQIS------NV---I------H------PHE---VILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVEIKEE--DIERFLRG-K-FTLKDMYAQLEAMRKMGP----------------------ISIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSMNKRQLS----------
23 PsiBlast_CBE 80.4150% -92 - C7 -2FFH SRP54_THEAQ B:[2-418] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGEARL-------PVLKDR--NLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDVASLAEKVRAA--------------EL-------SLEDFLKQMQNLKRLGPFSEILGLLPGV--P---QGLK---VDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSLE-----K---------
24 PsiBlast_CBE 80.3156%-109 - C8 -4C7O SRP54_ECOLI C:[2-298] --FDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNELVAAMGEENQT-------LNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLRE-KHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVH------AS---I------N------PVE---TLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMG-----------------------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 79.8352%-123 - C8 -2J46 SRP54_THEAQ B:[2-297] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGE-AR-------LPVLK-DRNLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDV---------------------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 79.6052%-123 - C8 -2J45 SRP54_THEAQ A:[2-297] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGE-AR-------LPVLK-DRNLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDV---------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 79.5652%-123 - C8 -2J46 SRP54_THEAQ A:[2-296] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGE-AR-------LPVLK-DRNLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGD----------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 79.3746% - - C8 -2IY3 - SRP54_SULSO (first) A:[2-429] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGE-AR-------LPVLK-DRNLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDIESILEKVKGLEEYDKIQKK--MEDVMEGK-GKLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLK------------------
80 HHSearch 79.2949% -91 - C7 -2FFH SRP54_THEAQ A:[1-418] -MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGEAR---------LPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKG-K-GRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDVASLAEKVRAA--------------------E-LSLEDFLKQMQNLKRLGPFSEILGLLPGVPQG---L-----KVDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSLEK--------------
10 PsiBlast_PDB 78.9452%-117 - C8 -2C04 SRP54_THEAQ A:[2-297] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGE-AR-------LPVLK-DRNLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDV---------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 78.8550% -90 - C7 -2FFH SRP54_THEAQ A:[2-418] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGEARL-------PVLKDR--NLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDVASLAEKVRAA--------------EL-------SLEDFLKQMQNLKRLGPFSEILGLLPGV--P---QGLK---VDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSLE-----K---------
8 PsiBlast_PDB 78.7952%-118 - C8 -2C03 SRP54_THEAQ A:[2-295] --FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGE-AR-------LPVLK-DRNLWFLVGLQGSGKTTTAAKLA-LYYK-GKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLK------EV---L------G------PDE---VLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMG-----------------------------------------------------------------------------------------------------------------------------------------------------------