@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu16150: (2016-06-25 )
MSSFHATTIFAVQHKGRSAMSGDGQVTFGQAVVMKHTARKVRKLFNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSDKVLRKLEAMLIVMNQDTLLLVSGTGEVIEPDDGILAIGSGGNYALAAGRALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE

Atome Classification :

(20 SA) .........10........20........30.-.......40...-.....50........60........70........80........90.-.......100.......110.......120.-......130.......140--........150.......160.......170.......180
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
1 PsiBlast_PDB 100.00100% 0 - C- -1YYF - CLPQ_BACSU D:[2-181] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
3 PsiBlast_PDB 92.18100% -99 - C8 -2Z3B CLPQ_BACSU A:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
24 PsiBlast_CBE 91.34100%-103 - C8 -2Z3B CLPQ_BACSU I:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
31 PsiBlast_CBE 91.17100% -98 - C8 -2Z3B CLPQ_BACSU B:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
26 PsiBlast_CBE 91.07100%-105 - C8 -2Z3B CLPQ_BACSU G:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
27 PsiBlast_CBE 91.04100% -99 - C8 -2Z3B CLPQ_BACSU F:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
30 PsiBlast_CBE 91.00100%-102 - C8 -2Z3B CLPQ_BACSU C:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
25 PsiBlast_CBE 90.89100%-102 - C8 -2Z3B CLPQ_BACSU H:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
23 PsiBlast_CBE 90.70100%-100 - C8 -2Z3B CLPQ_BACSU J:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
21 PsiBlast_CBE 90.34100%-103 - C8 -2Z3B CLPQ_BACSU L:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
29 PsiBlast_CBE 90.22100% -94 - C8 -2Z3B CLPQ_BACSU D:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
28 PsiBlast_CBE 90.13100%-101 - C8 -2Z3B CLPQ_BACSU E:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
22 PsiBlast_CBE 89.29100% -98 - C8 -2Z3B CLPQ_BACSU K:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
35 PsiBlast_CBE 88.8178%-113 - C8 -3TY6 HSLV_BACAN B:[6-183] --NFHATTIFAVHHNGECAMAGDGQVTMGNAV-VMKHTARKVRKL-FQGKVLAGFAGSVADAFTLFEMFEGKLEEYNGNLQRAAVEMAKQWRGD-KMLRQLEAMLIVMDKTTMLLVSGTGEVIEPD-DGILAIGSGGNYALSAGR---ALKQYASEHLTAKQIAKASLEIAGDICVYTNHNIIVEEL-
2 PsiBlast_PDB 88.59100% -94 - C8 -2Z3A - CLPQ_BACSU A:[1-180] -SSFHATTIFAVQHKGRSAMSGDGQVTFGQAV-VMKHTARKVRKL-FNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSD-KVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD-DGILAIGSGGNYALAAGR---ALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE
33 PsiBlast_CBE 87.3678%-109 - C8 -3TY6 HSLV_BACAN E:[6-183] --NFHATTIFAVHHNGECAMAGDGQVTMGNAV-VMKHTARKVRKL-FQGKVLAGFAGSVADAFTLFEMFEGKLEEYNGNLQRAAVEMAKQWRGD-KMLRQLEAMLIVMDKTTMLLVSGTGEVIEPD-DGILAIGSGGNYALSAGR---ALKQYASEHLTAKQIAKASLEIAGDICVYTNHNIIVEEL-
32 PsiBlast_CBE 87.0878%-118 - C8 -3TY6 HSLV_BACAN F:[6-183] --NFHATTIFAVHHNGECAMAGDGQVTMGNAV-VMKHTARKVRKL-FQGKVLAGFAGSVADAFTLFEMFEGKLEEYNGNLQRAAVEMAKQWRGD-KMLRQLEAMLIVMDKTTMLLVSGTGEVIEPD-DGILAIGSGGNYALSAGR---ALKQYASEHLTAKQIAKASLEIAGDICVYTNHNIIVEEL-
34 PsiBlast_CBE 86.6478%-109 - C8 -3TY6 HSLV_BACAN C:[8-183] ----HATTIFAVHHNGECAMAGDGQVTMGNAV-VMKHTARKVRKL-FQGKVLAGFAGSVADAFTLFEMFEGKLEEYNGNLQRAAVEMAKQWRGD-KMLRQLEAMLIVMDKTTMLLVSGTGEVIEPD-DGILAIGSGGNYALSAGR---ALKQYASEHLTAKQIAKASLEIAGDICVYTNHNIIVEEL-
4 PsiBlast_PDB 85.5778%-110 - C8 -3TY6 HSLV_BACAN A:[6-183] --NFHATTIFAVHHNGECAMAGDGQVTMGNAV-VMKHTARKVRKL-FQGKVLAGFAGSVADAFTLFEMFEGKLEEYNGNLQRAAVEMAKQWRGD-KMLRQLEAMLIVMDKTTMLLVSGTGEVIEPD-DGILAIGSGGNYALSAGR---ALKQYASEHLTAKQIAKASLEIAGDICVYTNHNIIVEEL-
134 HHSearch 82.1589%-100 - C8 -2Z3B CLPQ_BACSU A:[2-180] --SFHATTIFAVQHKGRSAMSGDGQVTFGQ-AVVMKHTARKVRKLFNG-KVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKR-AAVELAKEWRSDKVLRKLEAMLIVMNQDTLLLVSGTGEVIEPDDG-ILAIGSGGNYALAAGRALKKHAGE---SMSASEIARAALETAGEICVYTNDQIILEELE