@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu16530: (2016-06-26 )
MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEGMKVVKRTTKLANELGVKVLTLYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQVRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYGGRTEIVSAAKSLAEKVKEGSLNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKEDHFLQALGEFQQRGRRFGGI

Atome Classification :

(53 SA) .........10........20........30........-40........50....-....60........70........80....-....90........100.......110.--..--..------..120.......130.......140.......150.......160.......170.......180.......-190--.......-.----.200.......210.......220.......230.......240.......250.......260
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIM-DGNGRWAKKRSLPRIA-GHHEGMKVVKRTTKLANELGVKVLTLYAFS-TENWKRPKMEVDFLMKLPEEFLNTYLPE--LV--EE------NVQVRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYGGRTEIVSAAKSLAEKVKEGSLNIEDIDES-L----FSTYLMT-E----SLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKEDHFLQALGEFQQRGRRFGGI
2 PsiBlast_PDB 85.1855%-104 - C4 -4H8E ISPT_STAAN A:[19-253] -------------------------LDSSNIPEHIAIIM-DGNGRWAKKRKMPRIK-GHYEGMQTIKKITRIASDIGVKYLTLYAFS-TENWSRPESEVNYIMNLPVNFLKTFLPE--LI--EK------NVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDET-Y----INNHLMT-K----DYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGL
3 PsiBlast_PDB 84.9555%-105 - C4 -4U82 ISPT_STAAN A:[19-253] -------------------------LDSSNIPEHIAIIM-DGNGRWAKKRKMPRIK-GHYEGMQTIKKITRIASDIGVKYLTLYAFS-TENWSRPESEVNYIMNLPVNFLKTFLPE--LI--EK------NVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDET-Y----INNHLMT-K----DYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGL
126 HHSearch 84.7954%-104 - C4 -4H8E ISPT_STAAN A:[19-253] -------------------------LDSSNIPEHIAIIM-DGNGRWAKKRKMPRIK-GHYEGMQTIKKITRIASDIGVKYLTLYAFS-TENWSRPESEVNYIMNLPVNFLKTFLPE--LI--EK------NVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDET-Y----INNHLMT-K----DYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGL
57 PsiBlast_CBE 83.9744%-122 - C4 -2VG3 DPDS_MYCTU B:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
56 PsiBlast_CBE 83.1944%-121 - C4 -2VG3 DPDS_MYCTU C:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
59 PsiBlast_CBE 83.1344%-123 - C4 -2VG2 DPDS_MYCTU D:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
54 PsiBlast_CBE 83.0244%-121 - C4 -4ONC DPDS_MYCTU A:[50-280] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRR----
61 PsiBlast_CBE 82.6744%-120 - C4 -2VG2 DPDS_MYCTU B:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
60 PsiBlast_CBE 82.4444%-119 - C4 -2VG2 DPDS_MYCTU C:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
62 PsiBlast_CBE 82.4144%-116 - C4 -2VG2 DPDS_MYCTU A:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
58 PsiBlast_CBE 82.4144%-118 - C4 -2VG3 DPDS_MYCTU A:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
53 PsiBlast_CBE 82.4144%-122 - C4 -4ONC DPDS_MYCTU B:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
55 PsiBlast_CBE 82.2144%-124 - C4 -2VG3 DPDS_MYCTU D:[50-282] -------------------------IPADRLPNHVAIVM-DGNGRWATQRGLARTE-GHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDT--LK--KL------GVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITES-T----IARHLQR-P----DIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG--
46 PsiBlast_CBE 82.2049%-124 - C4 -1UEH UPPS_ECOLI B:[20-241] ---------------------------------HVAIIM-DGNGRWAKKQGKIRAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKS--LH--RH------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEE-M----LNQHVCM-H----ELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRER-----
9 PsiBlast_PDB 82.1049%-117 - C4 -1X06 UPPS_ECOLI A:[20-240] ---------------------------------HVAIIM-DGNGRWAKKQGKIRAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKS--LH--RH------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEE-M----LNQHVCM-H----ELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
22 PsiBlast_CBE 81.6954% -99 - C4 -4Q9O ISPT_STRR6 B:[12-240] -----------------------------QVPAHIGIIM-DGNGRWAKKRMQPRVF-GHKAGMEALQTVTKAANKLGVKVITVYAFS-TENWTRPDQEVKFIMNLPVEFYDNYVPE--LH--AN------NVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEE-L----IGNYLFT-QHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRH------
50 PsiBlast_CBE 81.5645%-111 - C4 -5HC8 ? A:[13-243] -------------------------------PNHVAIII-DGHRKWAKSRGVTVQE-GHQTGVNNWKHIISRASQLGIKLLTIWALS-PQNFNRSKMEVDFLMRIYEDFLRSDVKE--LVTSQQ------DIQFSAIGDKSRLPEYLQDAISYAEGLSQANKGMHFILAVAYGGREDIVEAARKIAAKVEHGILRPDDIDEA-T----FEQHLMT-NIT--KFPSPDLLIRAAGEQRLSNFFLWQLPFTEFYFTPKLFPDFGEADLLDALASYRCRYRGFG--
10 PsiBlast_PDB 81.5549%-123 - C4 -1X07 UPPS_ECOLI A:[20-240] ---------------------------------HVAIIM-DGNGRWAKKQGKIRAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKS--LH--RH------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEE-M----LNQHVCM-H----ELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
8 PsiBlast_PDB 81.4249%-119 - C4 -1V7U UPPS_ECOLI A:[20-239] ---------------------------------HVAIIM-DGNGRWAKKQGKIRAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKS--LH--RH------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEE-M----LNQHVCM-H----ELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR-------
130 HHSearch 81.3543%-106 - C4 -5HC8 ? A:[9-244] ---------------------------DEVTPNHVAIII-DGHRKWAKSRGVTVQE-GHQTGVNNWKHIISRASQLGIKLLTIWALS-PQNFNRSKMEVDFLMRIYEDFLRSDVKELVTS--QQ------DIQFSAIGDKSRLPEYLQDAISYAEGLSQANKGMHFILAVAYGGREDIVEAARKIAAKVEHGILRPDDIDEA-T----FEQHLMT-NIT--KFPSPDLLIRAAGEQRLSNFFLWQLPFTEFYFTPKLFPDFGEADLLDALASYRCRYRGFGE-
51 PsiBlast_CBE 81.3445%-111 - C4 -5HC7 ? A:[13-238] -------------------------------PNHVAIII-DGHRKWAKSRGVTVQE-GHQTGVNNWKHIISRASQLGIKLLTIWALS-PQNFNRSKMEVDFLMRIYEDFLRSDVKE--LVTSQQ------DIQFSAIGDKSRLPEYLQDAISYAEGLSQANKGMHFILAVAYGGREDIVEAARKIAAKVEHGILRPDDIDEA-T----FEQHLMT-NIT--KFPSPDLLIRAAGEQRLSNFFLWQLPFTEFYFTPKLFPDFGEADLLDALASYRCR-------
127 HHSearch 81.1154% -99 - C4 -4Q9M ISPT_STRR6 A:[11-240] ----------------------------TQVPAHIGIIM-DGNGRWAKKRMQPRVF-GHKAGMEALQTVTKAANKLGVKVITVYAFS-TENWTRPDQEVKFIMNLPVEFYDNYVPE--LH--AN------NVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEE-L----IGNYLFT-QHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRH------
49 PsiBlast_CBE 80.9949%-118 - C4 -1X08 UPPS_ECOLI A:[20-240] ---------------------------------HVAIIM-AGNGRWAKKQGKIRAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKS--LH--RH------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEE-M----LNQHVCM-H----ELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE------
23 PsiBlast_CBE 80.9154%-103 - C4 -4Q9M ISPT_STRR6 B:[12-239] -----------------------------QVPAHIGIIM-DGNGRWAKKRMQPRVF-GHKAGMEALQTVTKAANKLGVKVITVYAFS-TENWTRPDQEVKFIMNLPVEFYDNYVPE--LH--AN------NVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEE-L----IGNYLFT-QHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRR-------
48 PsiBlast_CBE 80.6949%-118 - C4 -1X09 UPPS_ECOLI A:[20-239] ---------------------------------HVAIIM-AGNGRWAKKQGKIRAF-GHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKS--LH--RH------NVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEE-M----LNQHVCM-H----ELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR-------
5 PsiBlast_PDB 80.6454%-100 - C4 -4Q9M ISPT_STRR6 A:[12-240] -----------------------------QVPAHIGIIM-DGNGRWAKKRMQPRVF-GHKAGMEALQTVTKAANKLGVKVITVYAFS-TENWTRPDQEVKFIMNLPVEFYDNYVPE--LH--AN------NVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEE-L----IGNYLFT-QHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRH------