@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu16770: (2016-06-26 )
MNFGNVSTAMITPFDNKGNVDFQKLSTLIDYLLKNGTDSLVVAGTTGESPTLSTEEKIALFEYTVKEVNGRVPVIAGTGSNNTKDSIKLTKKAEEAGVDAVMLVTPYYNKPSQEGMYQHFKAIAAETSLPVMLYNVPGRTVASLAPETTIRLAADIPNVVAIKEASGDLEAITKIIAETPEDFYVYSGDDALTLPILSVGGRGVVSVASHIAGTDMQQMIKNYTNGQTANAALIHQKLLPIMKELFKAPNPAPVKTALQLRGLDVGSVRLPLVPLTEDERLSLSSTISEL

Atome Classification :

(53 SA) .........10........20........30........40........50........60........70.........80........90.-.......100.......110.......120.......130.......140.......150.......160.......170.......180--........190.......200.......210.......220..-.....230.......240.......250.......260.-..-....270.......280.......290-
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNFGNVSTAMITPFDNKGNVDFQKLSTLIDYLLKNGTDSLVVAGTTGESPTLSTEEKIALFEYTVKEVNG-RVPVIAGTGSNNTKDSIKLTKK-AEEAGVDAVMLVTPYYNKPSQEGMYQHFKAIAAETSLPVMLYNVPGRTVASLAPETTIRLAADIPNVVAIKEASGDLEAITKIIAETPE---DFYVYSGDDALTLPILSVGGRGVVSVASHIAGTDMQQMIKNYT-NGQTANAALIHQKLLPIMKELFKAPNPAPVKTALQLRGL-DV-GSVRLPLVPLTEDERLSLSSTISEL---
1 PsiBlast_PDB 91.9860%-108 - C4 -1XKY ? A:[11-299] IDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVVSVVDK-RVPVIAGTGSNNTHASIDLTKK-ATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAESTPLPVMLYNVPGRSIVQISVDTVVRL-SEIENIVAIKDAGGDVLTMTEIIEKTAD---DFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQ-AGEFKKAQKLHQLLVRVTDSLFMAPSPTPVKTALQMVGL-DV-GSVRLPLLPLTEEERVTLQSVMQSI---
21 PsiBlast_CBE 91.6960%-102 - C4 -1XKY ? D:[11-299] IDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVVSVVDK-RVPVIAGTGSNNTHASIDLTKK-ATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAESTPLPVMLYNVPGRSIVQISVDTVVRL-SEIENIVAIKDAGGDVLTMTEIIEKTAD---DFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQ-AGEFKKAQKLHQLLVRVTDSLFMAPSPTPVKTALQMVGL-DV-GSVRLPLLPLTEEERVTLQSVMQSI---
22 PsiBlast_CBE 90.7660%-101 - C4 -1XKY ? C:[11-299] IDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVVSVVDK-RVPVIAGTGSNNTHASIDLTKK-ATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAESTPLPVMLYNVPGRSIVQISVDTVVRL-SEIENIVAIKDAGGDVLTMTEIIEKTAD---DFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQ-AGEFKKAQKLHQLLVRVTDSLFMAPSPTPVKTALQMVGL-DV-GSVRLPLLPLTEEERVTLQSVMQSI---
104 HHSearch 90.7561%-106 - C4 -1XKY ? A:[12-299] -DFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVVSVVDK-RVPVIAGTGSNNTHASIDLTKK-ATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAESTPLPVMLYNVPGRSIVQISVDTVVRLS-EIENIVAIKDAGGDVLTMTEIIEKTAD---DFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQ-AGEFKKAQKLHQLLVRVTDSLFMAPSPTPVKTALQMVGL-DV-GSVRLPLLPLTEEERVTLQSVMQSI---
23 PsiBlast_CBE 89.5760%-106 - C4 -1XKY ? B:[11-299] IDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVVSVVDK-RVPVIAGTGSNNTHASIDLTKK-ATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAESTPLPVMLYNVPGRSIVQISVDTVVRL-SEIENIVAIKDAGGDVLTMTEIIEKTAD---DFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQ-AGEFKKAQKLHQLLVRVTDSLFMAPSPTPVKTALQMVGL-DV-GSVRLPLLPLTEEERVTLQSVMQSI---
2 PsiBlast_PDB 87.9760%-101 - C- -1XL9 - ? A:[2-290] IDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVVSVVDK-RVPVIAGTGSNNTHASIDLTKK-ATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAESTPLPVMLYNVPGRSIVQISVDTVVRL-SEIENIVAIKDAGGDVLTMTEIIEKTAD---DFAVYSGDDGLTLPAMAVGAKGIVSVASHVIGNEMQEMIAAFQ-AGEFKKAQKLHQLLVRVTDSLFMAPSPTPVKTALQMVGL-DV-GSVRLPLLPLTEEERVTLQSVMQSI---
31 PsiBlast_CBE 80.1046%-104 - C4 -3VFL ? B:[11-287] -----IITAFITPFHEDGSINFDAIPALIEHLLAHHTDGILLAGTTAESPTLTHDEELELFAAVQKVVNG-RVPLIAGVGTNDTRDSIEFVKEVAEFGGFAAGLAIVPYYNKPSQEGMYQHFKAIADASDLPIIIYNIPGRVVVELTPETMLRL-ADHPNIIGVKECTS-LANMAYLIEHKPE---EFLIYTGEDGDAFHAMNLGADGVISVASHTNGDEMHEMFTAIA-ESDMKKAAAIQRKFIPKVNALFSYPSPAPVKAILNYMGF-EA-GPTRLPLVPAPEED--------------
5 PsiBlast_PDB 78.3046%-102 - C4 -3VFL ? A:[11-285] -----IITAFITPFHEDGSINFDAIPALIEHLLAHHTDGILLAGTTAESPTLTHDEELELFAAVQKVVNG-RVPLIAGVGTNDTRDSIEFVKEVAEFGGFAAGLAIVPYYNKPSQEGMYQHFKAIADASDLPIIIYNIPGRVVVELTPETMLRL-ADHPNIIGVKECTS-LANMAYLIEHKPE---EFLIYTGEDGDAFHAMNLGADGVISVASHTNGDEMHEMFTAIA-ESDMKKAAAIQRKFIPKVNALFSYPSPAPVKAILNYMGF-EA-GPTRLPLVPAPEED--------------
55 PsiBlast_CBE 77.3442%-100 - C4 -2EHH DAPA_AQUAE E:[2-274] --FQGSIVALITPF-KEGEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG-RIKVIAGTGGNATHEAVHLTAH-AKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGE---SFSVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAAL-EGDFRRAREIHYYLHDLFKVLFIETNPIPVKTACWMLGM-CE-KEFRLPLTEMS-----------------
132 Fugue 77.2145% -95 - C4 -1DHP DAPA_ECOLI A:[1-292] -MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLA-KVKNIIGIKEATGNLTRVNQIKELVSD---DFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAA-EGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT-DTLRLPMTPITDSGRETVRAALKHAGLL
57 PsiBlast_CBE 77.1942%-100 - C4 -2EHH DAPA_AQUAE C:[2-274] --FQGSIVALITPF-KEGEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG-RIKVIAGTGGNATHEAVHLTAH-AKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGE---SFSVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAAL-EGDFRRAREIHYYLHDLFKVLFIETNPIPVKTACWMLGM-CE-KEFRLPLTEMS-----------------
120 HHSearch 76.8547% -87 - C4 -3FLU DAPA_NEIMB A:[6-293] TMLQGSLVALITPMNQDGSIHYEQLRDLIDWHIENGTDGIVAVGTTGESATLSVEEHTAVIEAVVKHVAK-RVPVIAGTGANNTVEAIALSQA-AEKAGADYTLSVVPYYNKPSQEGIYQHFKTIAEATSIPMIIYNVPGRTVVSMTNDTILRLA-EIPNIVGVKEASGNIGSNIELINRAPE---GFVVLSGDDHTALPFMLCGGHGVITVAANAAPKLFADMCRAAL-QGDIALARELNDRLIPIYDTMFCEPSPAAPKWAVSALGR-CE-PHVRLPLVPLTENGQAKVRAALKA----
119 HHSearch 76.6541% -97 - C4 -2EHH DAPA_AQUAE A:[1-288] -MFQGSIVALITPFKE-GEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG-RIKVIAGTGGNATHEAVHLTAH-AKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGE---SFSVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAAL-EGDFRRAREIHYYLHDLFKVLFIETNPIPVKTACWMLGM-CE-KEFRLPLTEMSPENENKLREVLKKY---
106 HHSearch 76.5744% -91 * C4 *3QZE DAPA_PSEAE A:[23-309] -MIAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVIRRVVDQVKG-RIPVIAGTGANSTREAVALTEA-AKSGGADACLLVTPYYNKPTQEGMYQHFRHIAEAVAIPQILYNVPGRTSCDMLPETVERLS-KVPNIIGIKEATGDLQRAKEVIERVGK---DFLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAM-RGDAAAARAINDRLMPLHKALFIESNPIPVKWALHEMGL-IP-EGIRLPLTWLSPRCHEPLRQAMRQ----
58 PsiBlast_CBE 76.4742% -98 - C4 -2EHH DAPA_AQUAE A:[2-274] --FQGSIVALITPF-KEGEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG-RIKVIAGTGGNATHEAVHLTAH-AKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGE---SFSVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAAL-EGDFRRAREIHYYLHDLFKVLFIETNPIPVKTACWMLGM-CE-KEFRLPLTEMS-----------------
56 PsiBlast_CBE 76.3542% -98 - C4 -2EHH DAPA_AQUAE D:[2-274] --FQGSIVALITPF-KEGEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAVKRAAG-RIKVIAGTGGNATHEAVHLTAH-AKEVGADGALVVVPYYNKPTQRGLYEHFKTVAQEVDIPIIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGE---SFSVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAAL-EGDFRRAREIHYYLHDLFKVLFIETNPIPVKTACWMLGM-CE-KEFRLPLTEMS-----------------
8 PsiBlast_PDB 76.3146% -94 - C4 -3PB0 DAPA_THEMA A:[8-284] --FRGVGTAIVTPFKN-GELDLESYERLVRYQLENGVNALIVLGTTGESPTVNEDEREKLVSRTLEIVDG-KIPVIVGAGTNSTEKTLKLVKQ-AEKLGANGVLVVTPYYNKPTQEGLYQHYKYISERTDLGIVVYNVPGRTGVNVLPETAARIAADLKNVVGIKEANPAAAQIDRTVSLTKQARSDFMVWSGNDDRTFYLLCAGGDGVISVVSNVAPKQMVELCAEYF-SGNLEKSREVHRKLRPLMKALFVETNPIPVKAALNLMGF-IE-NELRLPLVPASE----------------
36 PsiBlast_CBE 76.3046% -97 - C4 -3PB0 DAPA_THEMA D:[8-284] --FRGVGTAIVTPFKN-GELDLESYERLVRYQLENGVNALIVLGTTGESPTVNEDEREKLVSRTLEIVDG-KIPVIVGAGTNSTEKTLKLVKQ-AEKLGANGVLVVTPYYNKPTQEGLYQHYKYISERTDLGIVVYNVPGRTGVNVLPETAARIAADLKNVVGIKEANPAAAQIDRTVSLTKQARSDFMVWSGNDDRTFYLLCAGGDGVISVVSNVAPKQMVELCAEYF-SGNLEKSREVHRKLRPLMKALFVETNPIPVKAALNLMGF-IE-NELRLPLVPASE----------------
28 PsiBlast_CBE 76.0546% -90 - C4 -3PB2 DAPA_THEMA D:[8-284] --FRGVGTAIVTPFKN-GELDLESYERLVRYQLENGVNALIVLGTTGESPTVNEDEREKLVSRTLEIVDG-KIPVIVGAGTNSTEKTLKLVKQ-AEKLGANGVLVVTPYYNKPTQEGLYQHYKYISERTDLGIVVYNVPGRTGVNVLPETAARIAADLKNVVGIKEANPDIDQIDRTVSLTKQARSDFMVWSGNDDRTFYLLCAGGDGVISVVSNVAPKQMVELCAEYF-SGNLEKSAEVHAKLRPLMKALFVETNPIPVKAALNLMGF-IE-NELRLPLVPASE----------------
18 PsiBlast_PDB 75.9845% -96 - C4 -1S5T - DAPA_ECOLI A:[8-288] --------AIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGVTGESATLNHDEHADVVMMTLDLADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRL-AKVKNIIGIKEATGNLTRVNQIKELVSD---DFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAA-EGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT-DTLRLPMTPITDSGRETVRAALKH----
39 PsiBlast_CBE 75.1945% -93 - C4 -1YXD DAPA_ECOLI B:[8-288] --------AIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRL-AKVKNIIGIKEATGNLTRVNQIKELVSD---DFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAA-EGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT-DTLRLPMTPITDSGRETVRAALKH----
14 PsiBlast_PDB 75.1545% -94 - C4 -3I7R DAPA_ECOLI A:[8-288] --------AIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRL-AKVKNIIGIREATGNLTRVNQIKELVSD---DFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAA-EGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT-DTLRLPMTPITDSGRETVRAALKH----
44 PsiBlast_CBE 75.0945% -96 - C4 -3I7Q DAPA_ECOLI B:[8-288] --------AIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRL-AKVKNIIGIREATGNLTRVNQIKELVSD---DFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAA-EGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT-DTLRLPMTPITDSGRETVRAALKH----
13 PsiBlast_PDB 75.0745% -95 - C4 -3I7Q DAPA_ECOLI A:[8-288] --------AIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRL-AKVKNIIGIREATGNLTRVNQIKELVSD---DFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAA-EGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT-DTLRLPMTPITDSGRETVRAALKH----
3 PsiBlast_PDB 74.8249% -90 - C4 -3FLU DAPA_NEIMB A:[14-282] --------ALITPMNQDGSIHYEQLRDLIDWHIENGTDGIVAVGTTGESATLSVEEHTAVIEAVVKHVAK-RVPVIAGTGANNTVEAIALSQA-AEKAGADYTLSVVPYYNKPSQEGIYQHFKTIAEATSIPMIIYNVPGRTVVSMTNDTILRL-AEIPNIVGVKEASGNIGSNIELINRAPE---GFVVLSGDDHTALPFMLCGGHGVITVAANAAPKLFADMCRAAL-QGDIALARELNDRLIPIYDTMFCEPSPAAPKWAVSALGR-CE-PHVRLPLVPLTEN---------------
35 PsiBlast_CBE 74.7347% -93 - C4 -3G0S DAPA_SALTY B:[32-303] --------ALVTPMDEKGNVSRSCLKKLIDYHVANGTSAIVSVGTTGESATLSHDEHGDVVMMTLELADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPTQEGLFQHFKAIAEHTDLPQILYNVPSRTGCDMLPETVGRL-AEIKNIIAIKEATGNLTRVHQIKELVSD---DFILLSGDDASALDFMQLGGHGVISVTANVAAREMADMCKLAA-EGQFAEARAINQRLMPLHNKLFVEPNPIPVKWACKALGLVAT-DTLRLPMTPITDHGR-------------
38 PsiBlast_CBE 74.6345% -92 - C4 -2ATS DAPA_ECOLI B:[8-288] --------AIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADG-RIPVIAGTGANATAEAISLTQR-FNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRL-AKVKNIIGIKEATGNLTRVNQIKELVSD---DFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAA-EGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT-DTLRLPMTPITDSGRETVRAALKH----