@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu16870: (2016-06-26 )
MNKTALITGASGGIGKSISETLAARGYNLLLHYNTNQNAAAELAEKLSQMFGVNAEILQADLSAQDGADKLTSSIVQPIDAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIRNKSGAIVAVSSIWGETGASCEVLYSMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAVDTNMMNQFTPAEKEEIADEIPIGRLARPQEIADATAFLLSEKASYITGQILSVNGGWHC

Atome Classification :

(22 SA) .........10........20........30........40........50........60.......----.70.---...---..---.---.80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190...-....200.......210.......220.......230.......240
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNKTALITGASGGIGKSISETLAARGYNLLLHYNTNQNAAAELAEKLSQMFGVNAEILQADLSAQDGA----DKLT---SSI---VQ---P---IDAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIRNKSGAIVAVSSIWGETGASCEVLYSMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAVDTNMMNQFTPAE-KEEIADEIPIGRLARPQEIADATAFLLSEKASYITGQILSVNGGWHC
1 PsiBlast_PDB 81.5436% -98 - C1 -2PNF FABG_AQUAE A:[8-246] --KVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKA-VAEEIANKYGVKAHGVEMNLLSEESI----NKAF---EEIYNLVD---G---IDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEI-KQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGG---
21 PsiBlast_CBE 80.4536%-102 - C1 -2PNF FABG_AQUAE B:[8-246] --KVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKA-VAEEIANKYGVKAHGVEMNLLSEESI----NKAF---EEIYNLVD---G---IDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEI-KQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGG---
2 PsiBlast_PDB 80.4236% -97 - C1 -2P68 - FABG_AQUAE A:[8-246] --KVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKA-VAEEIANKYGVKAHGVEMNLLSEESI----NKAF---EEIYNLVD---G---IDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEI-KQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGG---
107 HHSearch 78.6733%-145 - C1 -1O5I - ? A:[18-245] RDKGVLVLAASRGIGRAVADVLSQEGAEVTICARNEE-LLK-------R---SGHRYVVCDLRKD--L----DLLF---EK----VK---E---VDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKELLSEEKKKQVESQIPMRRMAKPEEIASVVAFLCSEKASYLTGQTIVVDGGLS-
76 PsiBlast_CBE 78.5832%-129 - C1 -4BO2 FABG_PSEAE B:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGI-----------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
75 PsiBlast_CBE 78.4132%-122 - C1 -4BO2 FABG_PSEAE D:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGI-------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
89 PsiBlast_CBE 78.2832%-125 - C1 -4BNY FABG_PSEAE C:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGIT----------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
92 PsiBlast_CBE 78.1132%-129 - C1 -4BNX FABG_PSEAE D:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAG--------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
96 PsiBlast_CBE 78.0532%-121 - C1 -4BNW FABG_PSEAE D:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGI------VRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
22 PsiBlast_CBE 77.9333% -96 - C1 -3SJ7 ? B:[9-251] MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEI-KAKGVDSFAIQANVADADEV----KAMI---KEV---VSQFGS---LDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD-TDALSDEL-KEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY-
8 PsiBlast_PDB 77.1435%-109 - C1 -2PH3 - ? A:[2-241] --RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVAVLGANLLEAEAA----TALVHQAAEV---LG---G---LDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEV-KEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGG---
82 PsiBlast_CBE 76.5332%-129 - C1 -4BO0 FABG_PSEAE B:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGI-----------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
24 PsiBlast_CBE 76.5033%-108 - C1 -1Q7B FABG_ECOLI C:[6-242] --KIALVTGASRGIGRAIAETLAARGAKVI-GTATSENGA----QAISDYLGANGKGLMLNVTDPASI----ESVL---EKIRAEFG---E---VDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMY-
60 PsiBlast_CBE 76.3232%-126 - C1 -4BO7 FABG_PSEAE A:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNA-----------KDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
95 PsiBlast_CBE 76.2832%-125 - C1 -4BNX FABG_PSEAE A:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNA---------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
67 PsiBlast_CBE 76.1732%-120 - C1 -4BO4 FABG_PSEAE D:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGIT-----VRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
66 PsiBlast_CBE 76.1632%-124 - C1 -4BO5 FABG_PSEAE B:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAG----------KDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
80 PsiBlast_CBE 76.0332%-124 - C1 -4BO0 FABG_PSEAE D:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGI-------RMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
85 PsiBlast_CBE 76.0232%-124 - C1 -4BNZ FABG_PSEAE C:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAG------------DEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
88 PsiBlast_CBE 75.5832%-120 - C1 -4BNY FABG_PSEAE D:[28-267] --KVALVTGASRGIGQAIALELGRLGA-VVIGTATSASGAEKIAETL-KANGVEGAGLVLDVSSDESVAATLEHIQ---QHL---GQ---P---L-IVVNNAGI------VRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQ-REALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-
39 PsiBlast_CBE 70.0832%-108 - C1 -3RRO FABG_VIBCH B:[13-249] --KVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQA-----ISDYLGDNGKGMALNVTNPESI----EAVL---KAI---TD---EFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQ-RTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY-
12 PsiBlast_PDB 69.5832%-107 - C1 -3RRO FABG_VIBCH A:[13-249] --KVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQA-----ISDYLGDNGKGMALNVTNPESI----EAVL---KAI---TD---EFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQ-RTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY-