@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu17600: (2016-06-28 )
MAQSHSSSINYFGSANKVVYEGKDSTNPLAFKYYNPQEVIGGKTLKEHLRFSIAYWHTFTADGTDVFGAATMQRPWDHYKGMDLAKMRVEAAFEMFEKLDAPFFAFHDRDIAPEGSTLKETNQNLDMIMGMIKDYMRNSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGLETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMAVDYAKEIGYTGQFLIEPKPKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGSVDANQGHPLLGWDTDEFPTDLYSTTLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLIYAHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEGIGLEIIEGRANFHTLEQYALNHKSIKNESGRQEKLKAILNQYILEV

Atome Classification :

(75 SA) .........10........20........30........40........50........60........70......-.-.80.-........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260....-...270.......280.......290.......300.......310...-....320........330.......-340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440...-----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAQSHSSSINYFGSANKVVYEGKDSTNPLAFKYYNPQEVIGGKTLKEHLRFSIAYWHTFTADGTDVFGAATMQRPWD-H-YK-G-MDLAKMRVEAAFEMFEKLDAPFFAFHDRDIAPEGSTLKETNQNLDMIMGMIKDYMRNSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGLETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMAVDYAKEIGYTGQFLIEPKPKEPTTHQYDTDAATTIAFLKQYGLD-NHFKLNLEANHATLAGHTFEHELRMARVHGLLGSVDANQGHPLLGWDTD-EFPTD-LYSTTLAMYEILQNGGLGS-GGLNFDAKVRRSSFEPDDLIYAHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEGIGLEIIEGRANFHTLEQYALNHKSIKNESGRQEKLKAILNQYILEV-----
1 PsiBlast_PDB 93.6676% -75 - C3 -1A0D XYLA_GEOSE A:[2-436] ----------YFDNISTIAYEGPASKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFGAGNMIRPWN-K-YS-G-MDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDIIVDMIEEYMKTSKTKLLWNTANLFTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGAENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQYDFDVATALAFLQTYGLK-DYFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDMLLGWDTD-EFPTD-LYSTTLAMYEILKNGGLGR-GGLNFDAKVRRGSFEPEDLFYAHIAGMDSFAVGLKVAHRLIEDRVFDEFIEERYKSYTEGIGREIVEGTADFHKLEAHALQLGEIQNQSGRQERLKTLLNQYLLEV-----
22 PsiBlast_CBE 93.2976% -76 - C3 -1A0D XYLA_GEOSE C:[2-436] ----------YFDNISTIAYEGPASKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFGAGNMIRPWN-K-YS-G-MDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDIIVDMIEEYMKTSKTKLLWNTANLFTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGAENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQYDFDVATALAFLQTYGLK-DYFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDMLLGWDTD-EFPTD-LYSTTLAMYEILKNGGLGR-GGLNFDAKVRRGSFEPEDLFYAHIAGMDSFAVGLKVAHRLIEDRVFDEFIEERYKSYTEGIGREIVEGTADFHKLEAHALQLGEIQNQSGRQERLKTLLNQYLLEV-----
21 PsiBlast_CBE 93.2976% -76 - C3 -1A0D XYLA_GEOSE D:[2-436] ----------YFDNISTIAYEGPASKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFGAGNMIRPWN-K-YS-G-MDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDIIVDMIEEYMKTSKTKLLWNTANLFTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGAENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQYDFDVATALAFLQTYGLK-DYFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDMLLGWDTD-EFPTD-LYSTTLAMYEILKNGGLGR-GGLNFDAKVRRGSFEPEDLFYAHIAGMDSFAVGLKVAHRLIEDRVFDEFIEERYKSYTEGIGREIVEGTADFHKLEAHALQLGEIQNQSGRQERLKTLLNQYLLEV-----
23 PsiBlast_CBE 93.0876% -75 - C3 -1A0D XYLA_GEOSE B:[2-436] ----------YFDNISTIAYEGPASKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFGAGNMIRPWN-K-YS-G-MDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDIIVDMIEEYMKTSKTKLLWNTANLFTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGAENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQYDFDVATALAFLQTYGLK-DYFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDMLLGWDTD-EFPTD-LYSTTLAMYEILKNGGLGR-GGLNFDAKVRRGSFEPEDLFYAHIAGMDSFAVGLKVAHRLIEDRVFDEFIEERYKSYTEGIGREIVEGTADFHKLEAHALQLGEIQNQSGRQERLKTLLNQYLLEV-----
26 PsiBlast_CBE 90.5269% -71 - C3 -1A0C XYLA_THETU B:[3-436] ----------YFENVSKIKYEGPKSNNPYSFKFYNPEEVIDGKTMEEHLRFSIAYWHTFTADGTDQFGKATMQRPWN-H-YT-DPMDIAKARVEAAFEFFDKINAPYFCFHDRDIAPEGDTLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKELGGENYVFWGGREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEPTKHQYDFDVANVLAFLRKYDLD-KYFKVNIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTD-QFPTD-IRMTTLAMYEVIKMGGFDK-GGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDRVFDKFIEERYASYKDGIGADIVSGKADFRSLEKYALERSQIVNKSGRQELLESILNQYLF-------
24 PsiBlast_CBE 90.2369% -71 - C3 -1A0C XYLA_THETU D:[3-436] ----------YFENVSKIKYEGPKSNNPYSFKFYNPEEVIDGKTMEEHLRFSIAYWHTFTADGTDQFGKATMQRPWN-H-YT-DPMDIAKARVEAAFEFFDKINAPYFCFHDRDIAPEGDTLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKELGGENYVFWGGREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEPTKHQYDFDVANVLAFLRKYDLD-KYFKVNIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTD-QFPTD-IRMTTLAMYEVIKMGGFDK-GGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDRVFDKFIEERYASYKDGIGADIVSGKADFRSLEKYALERSQIVNKSGRQELLESILNQYLF-------
2 PsiBlast_PDB 90.0869% -71 - C3 -1A0C XYLA_THETU A:[3-436] ----------YFENVSKIKYEGPKSNNPYSFKFYNPEEVIDGKTMEEHLRFSIAYWHTFTADGTDQFGKATMQRPWN-H-YT-DPMDIAKARVEAAFEFFDKINAPYFCFHDRDIAPEGDTLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKELGGENYVFWGGREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEPTKHQYDFDVANVLAFLRKYDLD-KYFKVNIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTD-QFPTD-IRMTTLAMYEVIKMGGFDK-GGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDRVFDKFIEERYASYKDGIGADIVSGKADFRSLEKYALERSQIVNKSGRQELLESILNQYLF-------
25 PsiBlast_CBE 90.0369% -71 - C3 -1A0C XYLA_THETU C:[3-436] ----------YFENVSKIKYEGPKSNNPYSFKFYNPEEVIDGKTMEEHLRFSIAYWHTFTADGTDQFGKATMQRPWN-H-YT-DPMDIAKARVEAAFEFFDKINAPYFCFHDRDIAPEGDTLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKELGGENYVFWGGREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEPTKHQYDFDVANVLAFLRKYDLD-KYFKVNIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTD-QFPTD-IRMTTLAMYEVIKMGGFDK-GGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDRVFDKFIEERYASYKDGIGADIVSGKADFRSLEKYALERSQIVNKSGRQELLESILNQYLF-------
102 HHSearch 88.8969% -67 - C3 -1A0C XYLA_THETU A:[1-437] --------NKYFENVSKIKYEGPKSNNPYSFKFYNPEEVIDGKTMEEHLRFSIAYWHTFTADGTDQFGKATMQRPWN-HYTD-P-MDIAKARVEAAFEFFDKINAPYFCFHDRDIAPEGDTLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKELGGENYVFWGGREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEPTKHQYDFDVANVLAFLRKYDLDKY-FKVNIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTD-QFPTDIRMTTL-AMYEVIKMGGF-DKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDRVFDKFIEERYASYKDGIGADIVSGKADFRSLEKYALERSQIVNKSGRQELLESILNQYLFA------
27 PsiBlast_CBE 86.9263% -74 - C3 -1A0E XYLA_THENE D:[3-438] ----------FFPEIPKVQFEGKESTNPLAFKFYDPEEIIDGKPLKDHLKFSVAFWHTFVNEGRDPFGDPTADRPWN-R-YT-DPMDKAFARVDALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILDKVVERIKERMKDSNVKLLWGTANLFSHPRYMHGAATTCSADVFAYAAAQVKKALEITKELGGEGYVFWGGREGYETLLNTDLGFELENLARFLRMAVDYAKRIGFTGQFLIEPKPKEPTKHQYDFDVATAYAFLKSHGLD-EYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQGDLLLGWDTD-QFPTN-VYDTTLAMYEVIKAGGFTK-GGLNFDAKVRRASYKVEDLFIGHIAGMDTFALGFKVAYKLVKDGVLDKFIEEKYRSFREGIGRDIVEGKVDFEKLEEYIIDKETIELPSGKQEYLESLINSYIVKT-----
121 Fugue 86.9163% -73 - C3 -1A0E XYLA_THENE A:[1-443] --------AEFFPEIPKVQFEGKESTNPLAFKFYDPEEIIDGKPLKDHLKFSVAFWHTFVNEGRDPFGDPTADRPWN-R-YTDP-MDKAFARVDALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILDKVVERIKERMKDSNVKLLWGTANLFSHPRYMHGAATTCSADVFAYAAAQVKKALEITKELGGEGYVFWGGREGYETLLNTDLGFELENLARFLRMAVDYAKRIGFTGQFLIEPKPKEPTKHQYDFDVATAYAFLKSHGLD-EYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQGDLLLGWDTD-QFPTN-VYDTTLAMYEVIKAGGFTK-GGLNFDAKVRRASYKVEDLFIGHIAGMDTFALGFKVAYKLVKDGVLDKFIEEKYRSFREGIGRDIVEGKVDFEKLEEYIIDKETIELPSGKQEYLESLINSYIVKTILELR
3 PsiBlast_PDB 86.2163% -74 - C3 -1A0E XYLA_THENE A:[3-438] ----------FFPEIPKVQFEGKESTNPLAFKFYDPEEIIDGKPLKDHLKFSVAFWHTFVNEGRDPFGDPTADRPWN-R-YT-DPMDKAFARVDALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILDKVVERIKERMKDSNVKLLWGTANLFSHPRYMHGAATTCSADVFAYAAAQVKKALEITKELGGEGYVFWGGREGYETLLNTDLGFELENLARFLRMAVDYAKRIGFTGQFLIEPKPKEPTKHQYDFDVATAYAFLKSHGLD-EYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQGDLLLGWDTD-QFPTN-VYDTTLAMYEVIKAGGFTK-GGLNFDAKVRRASYKVEDLFIGHIAGMDTFALGFKVAYKLVKDGVLDKFIEEKYRSFREGIGRDIVEGKVDFEKLEEYIIDKETIELPSGKQEYLESLINSYIVKT-----
33 PsiBlast_CBE 78.8549% -64 - C3 -4XKM XYLA_BACTN C:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
29 PsiBlast_CBE 78.6049% -66 - C3 -4XKM XYLA_BACTN G:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
34 PsiBlast_CBE 78.3049% -67 - C3 -4XKM XYLA_BACTN B:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
30 PsiBlast_CBE 77.8449% -66 - C3 -4XKM XYLA_BACTN F:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
28 PsiBlast_CBE 77.8349% -66 - C3 -4XKM XYLA_BACTN H:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
32 PsiBlast_CBE 77.7249% -65 - C3 -4XKM XYLA_BACTN D:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
4 PsiBlast_PDB 77.3149% -64 - C3 -4XKM XYLA_BACTN A:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
31 PsiBlast_CBE 77.2949% -66 - C3 -4XKM XYLA_BACTN E:[24-458] --------KEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFGGGTKQFPWNGN-AD-A-IQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATIELGGENYVFWGGREGYMSLLNTDQKREKEHLAQMLTIARDYARARGFKGTFLIEPKPMEPTKHQYDVDTETVIGFLKAHGLD-KDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTD-QFPID-NYELTQAMMQIIRNGGLGT-GGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAALLDESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKTKGEPKQTSGKQELYEAILNMYC--------
52 PsiBlast_CBE 57.4931% -64 - C3 -4QDP XYLA_STRRU A:[10-306] -------------------------------------------------RFTFGLW-TVGWQGRDPFGDATRR---------------ALDPVESVRRLAE-LGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALDD----TGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERP-ELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLN-GQNGIKYDQDLRFGAG-DLRAAFWLVDLLESAGY-S-GPRHFDFKPPRT--EDFDGVWASAAGC------------------------------------------------------------------------------------
38 PsiBlast_CBE 57.3331% -65 - C3 -1O1H XYLA_STRRU B:[9-305] -------------------------------------------------RFTFGLW-TVGWQGRDPFGDATRR---------------ALDPVESVRRLAE-LGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALDD----TGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERP-ELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLN-GQNGIKYDQDLRFGAG-DLRAAFWLVDLLESAGY-S-GPRHFDFKPPRT--EDFDGVWASAAGC------------------------------------------------------------------------------------
18 PsiBlast_PDB 57.3231% -66 - C3 -3KCO XYLA_STRRU A:[10-306] -------------------------------------------------RFTFGLW-TVGWQGRDPFGDATRR---------------ALDPVESVRRLAE-LGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALDD----TGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERP-ELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLN-GQNGIKYDQDLRFGAG-DLRAAFWLVDLLESAGY-S-GPRHFDFKPPRT--EDFDGVWASAAGC------------------------------------------------------------------------------------
61 PsiBlast_CBE 57.3131% -65 - C3 -3QZA XYLA_STRRU A:[10-306] -------------------------------------------------RFTFGLW-TVGWQGRDPFGDATRR---------------ALDPVESVRRLAE-LGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALDD----TGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERP-ELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLN-GQNGIKYDQDLRFGAG-DLRAAFWLVDLLESAGY-S-GPRHFDFKPPRT--EDFDGVWASAAGC------------------------------------------------------------------------------------
67 PsiBlast_CBE 57.1131% -67 - C3 -3KBN XYLA_STRRU A:[10-306] -------------------------------------------------RFTFGLW-TVGWQGRDPFGDATRR---------------ALDPVESVRRLAE-LGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALDD----TGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERP-ELYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLN-GQNGIKYDQDLRFGAG-DLRAAFWLVDLLESAGY-S-GPRHFDFKPPRT--EDFDGVWASAAGC------------------------------------------------------------------------------------
63 PsiBlast_CBE 57.1131%