@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu17660: (2016-06-28 )
MTMQIKIKYLDETQTRISKIEQGDWIDLRAAEDVTIKKDEFKLVPLGVAMELPEGYEAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTEIKKGDRICQFRIMKKMPAVELVEVEHLGNEDRGGLGSTGTK

Atome Classification :

(41 SA) .........10...----.....-20........30........40........-50.--....--------...60........70........80........90........-100-........110.......120........130...--....140..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
23 PsiBlast_CBE 99.25100% 0 - C- -4APZ YNCF_BACSU Z:[3-144] --MQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
144 Fugue 96.00100%-126 - C7 -4AOO YNCF_BACSU A:[2-144] -TMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
3 PsiBlast_PDB 96.00100%-126 - C7 -4AOO YNCF_BACSU A:[2-144] -TMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
28 PsiBlast_CBE 95.92100%-124 - C7 -4AOZ YNCF_BACSU B:[2-144] -TMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
22 PsiBlast_CBE 95.90100%-116 - C7 -4B0H YNCF_BACSU B:[2-144] -TMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
30 PsiBlast_CBE 95.79100%-120 - C7 -4AOO YNCF_BACSU C:[3-144] --MQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
21 PsiBlast_CBE 95.64100%-118 - C7 -4B0H YNCF_BACSU C:[2-144] -TMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
29 PsiBlast_CBE 95.56100%-126 - C7 -4AOO YNCF_BACSU D:[3-144] --MQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
31 PsiBlast_CBE 95.51100%-122 - C7 -4AOO YNCF_BACSU B:[3-144] --MQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
27 PsiBlast_CBE 95.41100%-119 - C7 -4AOZ YNCF_BACSU C:[2-144] -TMQIKIKYLDETQ----TR----IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLGNEDR--GGLGSTGTK
5 PsiBlast_PDB 93.71100%-127 - C7 -4B0H YNCF_BACSU A:[2-131] -TMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLG---------------
4 PsiBlast_PDB 93.25100%-123 - C7 -4AOZ YNCF_BACSU A:[2-131] -TMQIKIKYLDETQ----TRISK-IEQGDWIDLRAAEDVTIKKDEFKLVPLGVA-MEL--PEGY--------EAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYAL-RD--TEIKKGDRICQFRIMKKMP-AVELVEVEHLG---------------
36 PsiBlast_CBE 92.84