@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu17880: (2016-06-28 )
MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSVKIIDPEGNDVTPEKLKREQRNNKLH

Atome Classification :

(20 SA) -----------------------------....--.....10........---20-........----30-----........40........50---------....-....60........------70......-----------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----------------------------MISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFRSSMKNTLKS---------VKII-DPEGNDVTPEKLKR------EQRNNKLH-----------------------------
2 PsiBlast_PDB 82.0598% -52 - C6 -3BHP - YNZC_BACSU A:[2-52] ------------------------------ISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFRSSMKNTLKS---------V-------------------------------------------------------------
3 PsiBlast_PDB 81.01100% -44 - C6 -2JVD - YNZC_BACSU A:[1-46] -----------------------------MISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFRSSMK----------------------------------------------------------------------------
7 HHSearch 79.7596% -41 - C6 -2JVD - YNZC_BACSU A:[1-48] -----------------------------MISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFRSSMKLE--------------------------------------------------------------------------
25 Fugue 71.88100% 8 - C6 -2HEP - YNZC_BACSU A:[1-42] -----------------------------MISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFR--------------------------------------------------------------------------------
5 HHSearch 71.88100% 8 - C6 -2HEP - YNZC_BACSU A:[1-42] -----------------------------MISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFR--------------------------------------------------------------------------------
1 PsiBlast_PDB 71.88100% 8 - C6 -2HEP - YNZC_BACSU A:[1-42] -----------------------------MISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFR--------------------------------------------------------------------------------
6 HHSearch 58.4998% 135 - C6 -3BHP - YNZC_BACSU A:[1-52] -----------------------------MISN--AKIARINELAAKAKA---GV-ITEEEKAE----QQ-----KLRQEYLKGFRSSMKNTLKS---------V-------------------------------------------------------------
33 Fugue 43.4218% 77 - C6 -2OA4 - ? A:[1-101] MMFLRKVEGPRSVTLPDGSIMTRADLPPANTRR--WVASRKIAVVRGVIY---GL-ITLAEAKQ----TY-----GLSDEEFNSWVSALAEH-----------------GKDALKVTALKKYR------QLLEHHHHHH---------------------------
20 HHSearch 40.9137% -8 - C6 -1B0N SINI_BACSU B:[16-34] -----------------------------------------VELMVEAKE---AN-ISPEEIRK------------------------------------------------------------------------------------------------------
34 Fugue 40.6912% 87 - C6 -2JRM - ? A:[1-60] ------------------------------MKR--QKRDRLERAQSQGYK---AG-LNGRSQEACPYQQV-----DARSYWLGGWRDARDEKQSG---------LYKL-EH-------------------------------------------------------
23 HHSearch 37.9430% 101 * C6 *4NDW - ESPR_MYCTU A:[3-51] --------------------------------T--TFAARLNRLFDTVYPPGRGP-HTSAEVIA----ALKAEGITMSAPYLSQLRSG------------------------------------------------------------------------------
31 Fugue 36.8021% 180 - C6 -2KPO - ? A:[1-110] -----------------------MLLYVLIISNDKKLIEEARKMAEKAN--------LELRTVK----TE-----DELKKYLEEFRKESQNIKVL---------ILVS-NDEELDKAKELAQK------MEIDVRTRKVTSPDEAKRWIKEFSEEGGSLEHHHHHH
12 HHSearch 36.6523%-106 - C6 -1LGH LHB1_PHAMO B:[5-26] -------------------------------------------------L---SG-LTEEEAIA------------VHDQFKTTFSA-------------------------------------------------------------------------------
11 HHSearch 36.3529% -23 - C6 -1NKZ LHB5_RHOAC B:[1-21] -----------------------------------------------------AT-LTAEQSEE------------LHKYVIDGTRV-------------------------------------------------------------------------------
32 Fugue 34.9311% 78 - C6 -2KPJ - ? A:[1-94] -----------------------------MVKD--KQKAIFSENLNSYIA---KSEKTQLEIAK----SI-----GVSPQTFNTWCKGIAIPRMG---------KVQA-LADYFNINKSDLIE------DKKLNIDTVPIESGYTLEHHHHHH-------------
26 Fugue 33.9013% 24 - C4 -2K5N - ? A:[1-74] -----------------------------MAMN--GTITTWF----KDKG---FG-FIKDENGD----NR-----YFHVIKVANPDLIKKDAAVT---------FEPTTNNKGLSAYAVKVVP------LEHHHHHH-----------------------------
10 HHSearch 33.5832% 58 - C6 -1T3W - DNAG_ECOLI A:[116-137] --------------------------------------LRQEELIARERT---HG-LSNEERLE------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 32.3433% 117 - C6 -2Q2E - TOP6B_METMA B:[179-238] ---------------------------------------------------------------------------EMRAAYVKGRRQSIYEYLKATAIVNPHARITLI-DPDGNE---------------------------------------------------
8 HHSearch 32.1236% 125 - C6 -4IM9 - ? A:[112-133] --------------------------------------KQIENLQAKERS---VG-LSTEEKRE------------------------------------------------------------------------------------------------------
30 Fugue 31.7520% 144 - C3 -2RNM - HETS_PODAS A:[217-295] --------------------------------------MKIDAIVGRNSA---KD-IRTEERAR----VQLGN--VVTAAALHGGIRISDQTTNS---------VETV-VGKGESRVLIGNEYGGKGFWDNHHHHHH-----------------------------