@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu18130: (2016-06-29 )
MKRSISIFITCLLITLLTMGGMLASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGIIDNPSVKNKMKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMDALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPAKDKPTQENGISVQYRAGDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYNAKNKGQNVDCDYAQLGCGNVTYKFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKTTKKITLYDQGKLIWGTEPN

Atome Classification :

(32 SA) .........10........20........30........40........50........60.......--.70-........80........90.....--.---..100...--.-.....110.......120.......130.......140........150.......160--........170---------..-.-......180.......190.......200.......210.......-220.......230......---------------.240.......250.......260.......270.......280.......290.......300-------------.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKRSISIFITCLLITLLTMGGMLASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--T---ADG--GII--D-NPSVKNKMKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMDALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPAKDKPTQENGISVQYRAGDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYNAKNKGQNVDCDYAQLGCGNVTYKFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKTTKKITLYDQGKLIWGTEPN
2 PsiBlast_PDB 90.7699% -62 - C1 -3PZU GUN2_BACSU A:[30-326] ----------------------------------PVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--T---ADG--GYI--D-NPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 90.6199% -65 - C1 -3PZT GUN2_BACSU B:[31-326] -----------------------------------VAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--T---ADG--GYI--D-NPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 90.0099% -65 - C1 -3PZT GUN2_BACSU A:[34-326] --------------------------------------NGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--T---ADG--GYI--D-NPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 89.7299% -57 - C1 -3PZV - GUN2_BACSU A:[34-331] ---------------------------------TPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--T---ADG--GYI--D-NPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 89.0899% -61 - C1 -3PZU GUN2_BACSU B:[30-326] ----------------------------------PVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ--WYG-EYVNKDSLKWLRDDWGITVFRAAMY--T---ADG--GYI--D-NPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQN-KEKAKEFFKEMSSLYGNTPN---VIYEIANEP-----------NG-D-VNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQL-KDANVMYALHFYAGTHGQF---------------LRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSA-------------LKPGASKTGGWRLSDLSASGTFVRENILG------------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 79.6568% -39 - C1 -1QHZ GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 79.3868% -37 - C1 -1H5V GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 79.3868% -35 - C1 -1W3K GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 79.1769% -39 - C1 -1LF1 - ? A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGITVFRAAMY--T---SSG--GYI--D-DPSVKEKVKETVEAAIDLGIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWDNQIKPYAEEVIPVIRDNDPNNIVIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATG--GVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 78.7768% -34 - C1 -1W3L GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 PsiBlast_PDB 78.7068% -33 - C1 -1H11 GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 78.5068% -34 - C1 -7A3H GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 78.3668% -35 - C1 -1H2J GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 78.0468% -33 - C1 -1HF6 GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 78.0468% -34 - C1 -8A3H GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 77.8668% -36 - C1 -1QI0 GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
79 HHSearch 77.8168% -35 * C1 *7A3H GUN5_BACAG A:[6-301] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NG-SDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 77.7968% -35 - C1 -6A3H GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 77.7168% -33 - C1 -5A3H GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 77.6968% -36 - C1 -4A3H GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 77.6768% -35 - C1 -1E5J GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 77.4368% -35 - C1 -1OCQ GUN5_BACAG A:[6-300] -----------------------------------VEEHGQLSISNGELVNERGEQVQLKGMSSHGLQ--WYG-QFVNYESMKWLRDDWGINVFRAAMY--T---SSG--GYI--D-DPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIY-KEEAKDFFDEMSELYGDYPN---VIYEIANEP-----------NGSD-VTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQL-ADPNVMYAFHFYAGTHGQN---------------LRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAA-------------LMPGANPTGGWTEAELSPSGTFVREKI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------