@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu18180: (2016-06-29 )
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGRNKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEHFIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQGHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIGRGAGNEIQLTDALREVCRKEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR

Atome Classification :

(43 SA) .........10........20........30........40........50........60........70........80........90.-..-.....100.......110.......120.--...--...130.....-.-.140-.-......--.150.......160.......170.--......180.........190.......200.......210.......220.......230.......240.-.......250.......260.......270.......280.......290.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGRNKRSIEDHFDRSAELEFNLREKGKTETLKEMQ-QI-ADLANIHYIRQKEPLGLGHAVLCAEHFIG--DEP--FAVLLGDDIMV-S-ETP--A-LRQLMD--VYDVYGTEVVGVQSVLPEDVSKYGI--INTSGSQ--GHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIGRGAGNEIQLTDALREVCRK-E-PIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR
22 PsiBlast_CBE 91.5047%-104 - C1 -2UX8 ? G:[12-291] --KPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGT-RL-KP-GNIAYVRQQEPMGLGHAVWCARDIVG--DEP--FAVLLPDDFMF-G-QPG--C-LKQMVD--AYNKVGGNLICAEEVPDDQTHRYGI--ITPGTQD--GVLTEVKGLVEKPAPGTAPSNLSVIGRYILQPEVMRILENQGKGAGGEIQLTDAMQRMIGD-Q-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAF--------------
23 PsiBlast_CBE 90.2747%-109 - C1 -2UX8 ? F:[12-291] --KPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGT-RL-KP-GNIAYVRQQEPMGLGHAVWCARDIVG--DEP--FAVLLPDDFMF-G-QPG--C-LKQMVD--AYNKVGGNLICAEEVPDDQTHRYGI--ITPGTQD--GVLTEVKGLVEKPAPGTAPSNLSVIGRYILQPEVMRILENQGK------QLTDAMQRMIGD-Q-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAF--------------
26 PsiBlast_CBE 89.4847%-108 - C1 -2UX8 ? C:[12-291] --KPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGT-RL-KP-GNIAYVRQQEPMGLGHAVWCARDIVG--DEP--FAVLLPDDFMF-G-QPG--C-LKQMVD--AYNKVGGNLICAEEVPDDQTHRYGI--ITPGTQD--GVLTEVKGLVEKPAPGTAPSNLSVIGRYILQPEVMRILENQG-------QLTDAMQRMIGD-Q-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAF--------------
25 PsiBlast_CBE 89.3347%-111 - C1 -2UX8 ? D:[12-291] --KPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGT-RL-KP-GNIAYVRQQEPMGLGHAVWCARDIVG--DEP--FAVLLPDDFMF-G-QPG--C-LKQMVD--AYNKVGGNLICAEEVPDDQTHRYGI--ITPGTQD--GVLTEVKGLVEKPAPGTAPSNLSVIGRYILQPEVMRILENQG-------QLTDAMQRMIGD-Q-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAF--------------
1 PsiBlast_PDB 89.1250% -42 - C1 -5I1F ? A:[11-292] ---KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIEAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVR-SIKPSHVDCFYVRQAEALGLGHAVLCAEKLVG--DNP--FAVILADDLLD-G-PTP--V-LRQMID--VFDHYHASVIGVEEIAPADSKSYGV--IDGKRWE--DDLFKLSGIVEKPEPAQAPSNFGVVGRYVLKPKIFKHLRGLKPGAGGELQLTDAIQSLLTD-E-QVLAYRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFERYL-------------
24 PsiBlast_CBE 88.3547%-111 - C1 -2UX8 ? E:[12-291] --KPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGT-RL-KP-GNIAYVRQQEPMGLGHAVWCARDIVG--DEP--FAVLLPDDFMF-G-QPG--C-LKQMVD--AYNKVGGNLICAEEVPDDQTHRYGI--ITPGTQD--GVLTEVKGLVEKPAPGTAPSNLSVIGRYILQPEVMRILENQ--------QLTDAMQRMIGD-Q-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAF--------------
77 HHSearch 87.2650% -38 - C1 -5I1F ? A:[9-287] -MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIEAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIK-PSHVDCFYVRQAEALGLGHAVLCAEKLVG--DNP--FAVILADDLLD-G-PTP--V-LRQMID--VFDHYHASVIGVEEIAPADSKSYGV--IDGKRWE--DDLFKLSGIVEKPEPAQAPSNFGVVGRYVLKPKIFKHLRGLKPGAGGELQLTDAIQSLLTD-E-QVLAYRYDGTRFDCGSKLGYLKATVEFALRHPEVAAD------------------
27 PsiBlast_CBE 85.8147%-108 - C1 -2UX8 ? B:[12-291] --KPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGT-RL-KP-GNIAYVRQQEPMGLGHAVWCARDIVG--DEP--FAVLLPDDFMF-G-QPG--C-LKQMVD--AYNKVGGNLICAEEVPDDQTHRYGI--ITPGTQD--GVLTEVKGLVEKPAPGTAPSNLSVIGRYILQPEVMRILENQG--------LTDAMQRMIGD-Q-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAF--------------
21 PsiBlast_CBE 83.6147%-132 - C1 -2UX8 ? H:[12-291] --KPLRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIAYELEATMAARGKSLDVLDGT-RL-KP-GNIAYVRQQEPMGLGHAVWCARDIVG--DEP--FAVLLPDDFMF-G-QPG--C-LKQMVD--AYNKVGGNLICAE-------------------------LTEVKGL--------------VIGRYILQPEVMRILEN---------QLTDAMQRMIGD-Q-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAF--------------
78 HHSearch 82.1348% -34 - C1 -3JUK ? A:[1-271] ---MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSY--------TNKENALKSIR-NI-IEKCCFSYVRQKQMKGLGHAILTGEALIG--NEP--FAVILADDLCI-S-HDHPSV-LKQMTS--LYQKYQCSIVAIEEVALEEVSKYGV--IRGEWLE--EGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR-K-RIIAYQFKGKRYDCGSVEGYIEASNAYYKK-------------------------
3 PsiBlast_PDB 81.0549% -32 - C1 -3JUK ? A:[2-266] ----IKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSY--------TNKENALKSIR-NI-IEKCCFSYVRQKQMKGLGHAILTGEALIG--NEP--FAVILADDLCI-SHDHP--SVLKQMTS--LYQKYQCSIVAIEEVALEEVSKYGV--IRGEWLE--EGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR-K-RIIAYQFKGKRYDCGSVEGYIEASN------------------------------
2 PsiBlast_PDB 81.0149% -29 - C1 -3JUJ - ? A:[2-266] ----IKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSYEIEHQIQGTNKENALKSIR-NI-IEKCCFSYVRQKQMKGLGHAILTGEALIG--NEP--FAVILADDLCI-SHDHP--SVLKQMTS--LYQKYQCSIVAIEEVALEEVSKYGV--IRGEWLE--EGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR-K-RIIAYQFKGKRYDCGSVEGYIEASN------------------------------
30 PsiBlast_CBE 80.1249% -26 - C1 -3JUK ? B:[2-266] ----IKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSY---------NKENALKSIR-NI-IEKCCFSYVRQKQMKGLGHAILTGEALIG--NEP--FAVILADDLCI-SHDHP--SVLKQMTS--LYQKYQCSIVAIEEVALEEVSKYGV--IRGEWLE--EGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR-K-RIIAYQFKGKRYDCGSVEGYIEASN------------------------------
32 PsiBlast_CBE 80.1142% -43 - C1 -2PA4 ? C:[12-297] ----VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIR-RA-ADLIKAVPVTQDKPLGLGHAVGLAESVLD--DDEDVVAVMLPDDLVL-P--TG--V-MERMAQ--VRAEFGGSVLCAVEVSEADVSKYGIFEIEADTKD--SDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGH-PVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQ----LKDAIKQ-------
29 PsiBlast_CBE 79.9449% -28 - C1 -3JUK ? C:[2-266] ----IKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSY---------NKENALKSIR-NI-IEKCCFSYVRQKQMKGLGHAILTGEALIG--NEP--FAVILADDLCI-SHDHP--SVLKQMTS--LYQKYQCSIVAIEEVALEEVSKYGV--IRGEWLE--EGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR-K-RIIAYQFKGKRYDCGSVEGYIEASN------------------------------
4 PsiBlast_PDB 79.8642% -41 - C1 -2PA4 ? A:[12-297] ----VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIR-RA-ADLIKAVPVTQDKPLGLGHAVGLAESVLD--DDEDVVAVMLPDDLVL-P--TG--V-MERMAQ--VRAEFGGSVLCAVEVSEADVSKYGIFEIEADTKD--SDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGH-PVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQ----LKDAIKQ-------
33 PsiBlast_CBE 79.5742% -39 - C1 -2PA4 ? B:[12-297] ----VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIR-RA-ADLIKAVPVTQDKPLGLGHAVGLAESVLD--DDEDVVAVMLPDDLVL-P--TG--V-MERMAQ--VRAEFGGSVLCAVEVSEADVSKYGIFEIEADTKD--SDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGH-PVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQ----LKDAIKQ-------
31 PsiBlast_CBE 78.8742% -42 - C1 -2PA4 ? D:[12-297] ----VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERSSELEETLMER---DQVEIIR-RA-ADLIKAVPVTQDKPLGLGHAVGLAESVLD--DDEDVVAVMLPDDLVL-P--TG--V-MERMAQ--VRAEFGGSVLCAVEVSEADVSKYGIFEIEADTKD--SDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDEGH-PVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQ----LKDAIKQ-------
28 PsiBlast_CBE 78.4949% -24 - C1 -3JUK ? D:[2-266] ----IKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSY--------TNKENALKSIR-NI-IEKCCFSYVRQKQMKGLGHAILTGEALIG--NEP--FAVILADDLCI-SHDHP--SVLKQMTS--LYQKYQCSIVAIEEVALEEVSKYGV--IRGEWLE--EGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR-K-RIIAYQFKGKRYDCGSVEGYIEASN------------------------------
73 HHSearch 78.1342% -37 - C1 -2PA4 ? A:[12-298] ----VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIR-RA-ADLIKAVPVTQDKPLGLGHAVGLAESVLDDDEDV--VAVMLPDDLVLPT-GV-----MERMAQ--VRAEFGGSVLCAVEVSEADVSKYGI--FEIEADTKDSDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQLTDAIDLLIDE-GHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQLKDAIKQI----------
61 PsiBlast_CBE 63.3231% -71 - C1 -1MP5 RMLA_SALTY D:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQAG--TAV----SLEEKPL--QPKSNYAVTGLFFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
42 PsiBlast_CBE 60.1031% -70 - C1 -1MP4 RMLA_SALTY B:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQAG--TAV----SLEEKPL--QPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
65 PsiBlast_CBE 59.7731% -67 - C1 -1MP3 RMLA_SALTY B:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGTAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQAG--TAV----SLEEKPL--QPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
62 PsiBlast_CBE 59.6131% -67 - C1 -1MP5 RMLA_SALTY C:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQAG--TAV----SLEEKPL--QPKSNYAVTGLFFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
47 PsiBlast_CBE 58.9331% -67 - C1 -1IIN RMLA_SALTY B:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQKG--TAV----SLEEKPL--QPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
64 PsiBlast_CBE 58.8331% -70 - C1 -1MP5 RMLA_SALTY A:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQAG--TAV----SLEEKPL--QPKSNYAVTGLFFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
16 PsiBlast_PDB 58.7431% -68 - C1 -1H5S RMLA1_ECOLI C:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
63 PsiBlast_CBE 58.2231% -71 - C1 -1MP5 RMLA_SALTY B:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQAG--TAV----SLEEKPL--QPKSNYAVTGLFFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
43 PsiBlast_CBE 58.0331% -68 - C1 -1MP4 RMLA_SALTY A:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQAG--TAV----SLEEKPL--QPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
46 PsiBlast_CBE 57.7831% -68 - C1 -1IIN RMLA_SALTY C:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQKG--TAV----SLEEKPL--QPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
48 PsiBlast_CBE 57.6431% -69 - C1 -1IIN RMLA_SALTY A:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQKG--TAV----SLEEKPL--QPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
14 PsiBlast_PDB 57.5431% -64 - C1 -1H5T RMLA1_ECOLI A:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
45 PsiBlast_CBE 56.9531% -67 - C1 -1IIN RMLA_SALTY D:[2-205] ---KTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--HDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDQKG--TAV----SLEEKPL--QPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINR---------------------------------------------------------------
37 PsiBlast_CBE 56.6931% -63 - C1 -1H5R RMLA1_ECOLI C:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
41 PsiBlast_CBE 55.5931% -65 - C1 -1H5S RMLA1_ECOLI D:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--ADD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
36 PsiBlast_CBE 55.4431% -61 - C1 -1H5R RMLA1_ECOLI D:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
34 PsiBlast_CBE 55.2731% -63 - C1 -1H5T RMLA1_ECOLI D:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
38 PsiBlast_CBE 55.0431% -68 - C1 -1H5T RMLA1_ECOLI B:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
15 PsiBlast_PDB 54.7031% -62 - C1 -1H5R RMLA1_ECOLI A:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
35 PsiBlast_CBE 53.8731% -61 - C1 -1H5T RMLA1_ECOLI C:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------
39 PsiBlast_CBE 52.8731% -63 - C1 -1H5S RMLA1_ECOLI B:[2-205] ---KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILII------STPQDTPRFQQLLGDGSQWG----------------LNLQYKVQPSPDGLAQAFIIGEEFIG--GDD--CALVLGDNIFY-G-HD-----LPKLMEAAVNKESGATVFAYHVNDPE---RYGV--VEFDKNG--TAI----SLEEKPL--EPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINR---------------------------------------------------------------