@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu18410: (2016-06-29 )
MKRTWNVCLTALLSVLLVAGSVPFHAEAKKPPKSYDEYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPKDKVEGQTTHFTVADRWGNVVSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAIPGGANEVQPNKRPLSSMTPTILFKDDKPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSMSSYRYEDGVPKDVLSKLNGMGHKFGTSPVDIGNVQSISIDHENGTFKGVADSSRNGAAIGINLKRK

Atome Classification :

(49 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130..-....-.140........150.......160.......170.......180.......190...-..-.--.200----.-.-.......210.-.......220.......230.......240.......250.......260.......270........280.......290.......300.......310..----.....320--.........330.......340......--.350.......360.......370.......380.......390.......400.......410.......420...-....430.......440......---------.---------450-------.----------.----------.......460.......470.-.....-.480.......490.......500.......510.......520---.-..-....-.-530.......540.....--.--.550.......560.--......570.....-..580.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKRTWNVCLTALLSVLLVAGSVPFHAEAKKPPKSYDEYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYD----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPKDKVEGQTTHFTVADRWGNVVSYTTTIEQL-FGTGIMVPDYGVILNNELTDFDA---------I---------P---------G----------G----------ANEVQPNKRPLSSMTPTILFK-DDKPV-LTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSM----S-SY-RYED-G-VPKDVLSKLNGMGHKFGT--S--PVDIGNVQSISIDHE--NGTFKGVADSSRNG-AAIGINLKRK
1 PsiBlast_PDB 82.4475% -54 * C3 *4Y23 ? A:[36-581] ---------------------------------------KVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIP-FSER-SRH-GNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQ-DK-L--SK------T-A-AKDIFLPD-GE-PLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVT-TDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYD----PKSFEK----YHLLAETMHLSYADRAAYAGDPEFVDVP--LRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIGEATHFTVTDQWGNVVSYTTTIEQL-FGTGILVPGYGLFLNNELTDFDA---------I---------P---------G----------G----------ANEVQPNKRPLSSMTPTIVFK-DEKPV-LTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSL----T-SY-RYES-G-MPEDVRRKLNDFGHKFGS--N--PVDIGNVQSIFIDRE--NKTFMGVADSSRNG-TAVGVNIK--
57 HHSearch 81.1675% -35 - C3 -4Y23 ? A:[35-582] --------------------------------------DKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIP-FSER-SRH-GNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQ-DK-L--SK------T-A-AKDIFLPD-GE-PLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVT-TDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYD----PKSFEK----YHLLAETMHLSYADRAAYAGDPEFVDVP--LRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIGEATHFTVTDQWGNVVSYTTTIE-QLFGTGILVPGYGLFLNNELTDFDA---------I---------P---------G----------G----------ANEVQPNKRPLSSMTPTIVFK-DEKPV-LTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSL----T-SY-RYES-G-MPEDVRRKLNDFGHKFGS--N--PVDIGNVQSIFIDRE--NKTFMGVADSSRNG-TAVGVNIKT-
3 PsiBlast_PDB 65.28100% -58 - C3 -3WHR - ? A:[37-395] ------------------------------------EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYD----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 64.6699% -58 - C3 -3A75 ? A:[19-377] ------------------------------------EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYD----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 64.59100% -58 - C3 -3WHS GGT_BACSU A:[53-411] ------------------------------------EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYD----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 64.48100% -58 - C3 -3WHQ - GGT_BACSU A:[37-396] ------------------------------------EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYD----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPK----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 64.2699% -53 - C3 -2V36 - GGT_BACSU A:[34-394] ---------------------------------SYDEYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMPKILDHFNLS--D----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 64.0199% -53 - C3 -3A75 ? C:[20-377] -------------------------------------YKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYD----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQP-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
61 HHSearch 63.06100% -70 - C3 -3WHR - ? A:[37-371] ------------------------------------EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIP-FSER-VTK-GTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQ-EK-L--SR------T-A-AKDVFLPN-GE-PLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDIT-IDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYD----VRSWEK----YQLLAETMHLSYADRASYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVN-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 58.6973% -53 - C3 -4OTU ? A:[36-397] ---------------------------------------KVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIP-FSER-SRH-GNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQ-DK-L--SK------T-A-AKDIFLPD-GE-PLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVT-TDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYD----PKSFEK----YHLLAETMHLSYADRAAYAGDPEFVDVP--LRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIG-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 58.1873% -58 - C3 -4OTT ? A:[36-391] ---------------------------------------KVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIP-FSER-SRH-GNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQ-DK-L--SK------T-A-AKDIFLPD-GE-PLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVT-TDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYD----PKSFEK----YHLLAETMHLSYADRAAYAGDPEFVDVP--LRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQP-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
59 HHSearch 54.4629% -6 - C- -2NLZ - ? A:[15-539] -------------------------------------RRNVVYAKNGMVATSQPLAAQAGLDILKAGGNAIDAAIATATALTVLEPTSNGIGSDAFALVWTKG--KLHGLNGSGRAPMSLTMEAVKAKGY---E-QELP-PYG-VIPVTVPGAPGAWAELAKMYGNLPLAASLAPAIRYAEEGYPVTPTLAKYWKAAY-DR-V--KTEWTDDVY-QPWFDTFAPK-GR-APRVGEVWRSQGHADTLRSIAESNGESFYRGELADQIHAFFDKHGGYLTKEDLACYRPE-WVEPISIDYRGYRVWEIPPNGQGLVA-LEALNIVKGFEFYHK------DTVDT----YHKQIEAMKLAFVDGMKYVTEPSDMSVS--VEQLLSDEYATERRKEIGEQALT-------PE--------------PGTP----TVYLATADGDGNMVSFIQSNY-MGFGSGVVVPGTGIAMQNRGHNFSL---------D---------P---------N----------H----------DNALKPGKRTYHTIIPGFLTK-NDQPI-GPFGVMGGFMQPQGHMQVMMNTIDFGLNPQAALDAPRWQWTNG----K-QV-QVEP-T-FPVDIAQALVRRGHKIQVVLD--EGAFGRGQIIWRDPT--TGVLAGGTEPRTDG-QVAAW-----
60 HHSearch 52.3224% -10 - C3 -2I3O - ? A:[5-515] --------------------------------------RPNALSQRSVIASSSELASLAGRDILKRGGNIFDAALAVSAMLCVTQNNLCGLGGDLFALIRDEN-GQIMDLNGSGQASRAVSIDYYESMGL---T-KIPE-RGP-YAAITVPGIAGSWDEIFRKFATMDIADILEPAIRTASAGFPITQNYSDSIARSA-PV-I--GQ------Y-RGWSSIFMPN-GS-VPVAGEILKQPDLAESFRLMSEEGFRSFYDGSLADIIIAGLEGTGSPLSDRDLRVYRPL-IGKPVFTDLDEFRIYETSPNSQGITV-IEWIRGMESHGYDSRT-----MWEAK----IEDIFETMEEAYDKRR-KITDPSYMN-------------------GL------------------P--K-------RDHNDIGDTTYFSISDSEGRSVSIIQSNY-MGFGSGIVPKGTGFVLQNRGSYFTL---------Q---------R---------D----------H----------PNALMPGKRTFHTLAACMVEK-EHDLY-ASLGSMGGDIQPQVQMQILMEILKDNTDPQAILDKPRWTEPYTIYEAPGAV-YVES-EELYRNVSKQISGRKVVLRD--V--SQEFGTAQITTLI-R--GDVVVGAADPRGDG-IAIPY-----
64 HHSearch 44.9741% 2 - C3 -2QMC ? A:[31-360] -----------------------------------------KNTKVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLAN-GENVALDFREKAPLKATKNMFLDKQGNV-V-PKLS-EDG-YLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEAR-ER-F--LK------Y-SSSKKYFFKKGHL-DYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVK-WRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALG----YGASKN----IHIAAEAMRQAYADRSVYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTVT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
65 HHSearch 44.5335% -86 - C3 -3G9K - CAPD_BACAN L:[18-309] -------------------------------------------KGTYGVSASHPLAVEEGMKVLKNGGSAVDAAIVVSYVLGVVELHASGIGGGGGMLIISKD--KETFIDYRETTPY---------------------------PHIGVPGFVAGMEYIHDNYGSLPMGELLQPAINYAEKGFKVDDSLTMRLDLAK-PR-I--YS--------D-KLSIFYPN-GE-PIETGETLIQTDLARTLKKIQKEGAKGFYEGGVARAISK-----TAKISLEDIKGYKVE-VRKPVKGNYMGYDVYTAPPPFSGVTL-LQMLKLAEKKEVYKDV----DHTATY----MSKMEEISRIAYQDRKKNLG------MD--PNKMVSDKYISTMK--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
63 HHSearch 44.2343% 13 - C3 -2DG5 ? A:[17-348] --------------------------------------FHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKN-GNTTAIDFREMAPAKATRDMFLDDQGNP-D-SKKS-LTS-HLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEV-L--PN------H-ENSKAIFWKE-GE-PLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAV-ERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYG----FGSADA----MQIMAEAEKYAYADRSEYLGDPDFVKVP--WQALTNKAYAKSIADQIDINKA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
62 HHSearch 43.7229% -37 - C3 -4GDX GGT1_HUMAN A:[33-363] --------------------------------------PDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSE--------QS-QKG-GLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKR-TV-I--EQ------Q-PVLCEVFCRD-RK-VLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAPLSGPVL-ALILNILKGYNFSRESVESPEQKGLT----YHRIVEAFRFAYAKRT-LLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTT------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
29 PsiBlast_CBE 43.6843% 26 - C3 -2Z8I ? C:[15-348] -----------------------------------DVFHPVRA-KQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRS-KNGNTTAIDFREMAPAKATRDMFLDDQGN--P-DSKKSLTS-HLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYG-SE-VLPNH------E-N-SKAIFWKE-GE-PLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAV-ERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYG----FGSADA----MQIMAEAEKYAYADRSEYLGDPDFVKVP--WQALTNKAYAKSIADQIDINKA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 43.4641% 25 - C3 -3FNM ? A:[34-359] --------------------------------------------KVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVAL-DFREKAPLKATKNMFLDKQGNVVPKLSED-GY---LAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEAR-ERFL--KY------S-S-SKKYFFKK-GHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVK-WRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALG----YGASKN----IHIAAEAMRQAYADRSVYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 43.4041% 30 - C3 -2QM6 ? A:[34-359] --------------------------------------------KVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVAL-DFREKAPLKATKNMFLDKQGNVVPKLSED-GY---LAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEAR-ERFL--KY------S-S-SKKYFFKK-GHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVK-WRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALG----YGASKN----IHIAAEAMRQAYADRSVYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
32 PsiBlast_CBE 43.3941% 26 - C3 -2QM6 ? C:[34-359] --------------------------------------------KVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVAL-DFREKAPLKATKNMFLDKQGNVVPKLSED-GY---LAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEAR-ERFL--KY------S-S-SKKYFFKK-GHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVK-WRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALG----YGASKN----IHIAAEAMRQAYADRSVYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 43.3741% 29 - C3 -2QMC ? A:[34-359] --------------------------------------------KVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVAL-DFREKAPLKATKNMFLDKQGNVVPKLSED-GY---LAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEAR-ERFL--KY------S-S-SKKYFFKK-GHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVK-WRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALG----YGASKN----IHIAAEAMRQAYADRSVYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
30 PsiBlast_CBE 43.1241% 27 - C3 -3FNM ? C:[34-359] --------------------------------------------KVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVAL-DFREKAPLKATKNMFLDKQGNVVPKLSED-GY---LAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEAR-ERFL--KY------S-S-SKKYFFKK-GHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVK-WRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALG----YGASKN----IHIAAEAMRQAYADRSVYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
31 PsiBlast_CBE 42.9941% 28 - C3 -2QMC ? C:[34-359] --------------------------------------------KVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVAL-DFREKAPLKATKNMFLDKQGNVVPKLSED-GY---LAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEAR-ERFL--KY------S-S-SKKYFFKK-GHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVK-WRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALG----YGASKN----IHIAAEAMRQAYADRSVYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 37.98100% -39 - C3 -3A75 ? B:[1-182] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHFTVADRWGNVVSYTTTIEQL-FGTGIMVPDYGVILNNELTDFDA---------I---------P---------G----------G----------ANEVQPNKRPLSSMTPTILFK-DDKPV-LTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSM----S-SY-RYED-G-VPKDVLSKLNGMGHKFGT--S--PVDIGNVQSISIDHE--NGTFKGVADSSRNG-AAIGINL---
33 PsiBlast_CBE 37.5232% 14 - C3 -4GDX GGT1_HUMAN A:[50-338] -------------------------------------------------------CSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNS---------SEQ-SQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKR-TV-I--EQ------QPV-LCEVFCRD-RK-VLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAE-LIEHPLNISLGDAVLYMPSAPLSGPVLALILNILKGYNFSRES----VESPEQKGLTYHRIVEAFRFAYAKR-TLLGDPKFVDV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 37.50100% -31 - C3 -3A75 ? D:[1-184] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHFTVADRWGNVVSYTTTIEQL-FGTGIMVPDYGVILNNELTDFDA---------I---------P---------G----------G----------ANEVQPNKRPLSSMTPTILFK-DDKPV-LTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSM----S-SY-RYED-G-VPKDVLSKLNGMGHKFGT--S--PVDIGNVQSISIDHE--NGTFKGVADSSRNG-AAIGINLKR-
22 PsiBlast_CBE 37.07100% -35 - C3 -3WHS ? B:[1-183] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHFTVADRWGNVVSYTTTIEQL-FGTGIMVPDYGVILNNELTDFDA---------I---------P---------G----------G----------ANEVQPNKRPLSSMTPTILFK-DDKPV-LTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSM----S-SY-RYED-G-VPKDVLSKLNGMGHKFGT--S--PVDIGNVQSISIDHE--NGTFKGVADSSRNG-AAIGINLK--
25 PsiBlast_CBE 35.1979% -38 - C3 -4OTU ? B:[1-182] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHFTVTDQWGNVVSYTTTIEQL-FGTGILVPGYGLFLNNELTDFDA---------I---------P---------G----------G----------ANEVQPNKRPLSSMTPTIVFK-DEKPV-LTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSL----T-SY-RYES-G-MPEDVRRKLNDFGHKFGS--N--PVDIGNVQSIFIDRE--NKTFMGVADSSRNG-TAVGVNI---
39 PsiBlast_CBE 28.6444% -7 - C3 -3FNM ? D:[1-169] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVADRWGNAVSVTYTINAS-YGSAASIDGAGFLLNNEMDDFSI---------K---------P---------G----------NPNLYGLVGGDANAIEANKRPLSSMSPTIVLK-NNKVF-LVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP---D-EL-RIEKFG-MPADVKDNLTKMGYQIVT--K--PV-MGDVNAIQV------------------------------
44 PsiBlast_CBE 28.2243% -9 - C3 -2QMC ? B:[2-169] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THYSVADRWGNAVSVTYTINAS-YGSAASIDGAGFLLNNEMDDFSI---------K---------P---------G----------NPNLYGLVGGDANAIEANKRPLSSMSPTIVLK-NNKVF-LVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP---D-EL-RIEKFG-MPADVKDNLTKMGYQIVT--K--PV-MGDVNAIQV------------------------------
41 PsiBlast_CBE 28.0344% -4 - C3 -2QM6 ? D:[1-169] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVADRWGNAVSVTYTINAS-YGSAASIDGAGFLLNNEMDDFSI---------K---------P---------G----------NPNLYGLVGGDANAIEANKRPLSSMSPTIVLK-NNKVF-LVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP---D-EL-RIEKFG-MPADVKDNLTKMGYQIVT--K--PV-MGDVNAIQV------------------------------
40 PsiBlast_CBE 27.9544% -3 - C3 -3FNM ? B:[1-169] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVADRWGNAVSVTYTINAS-YGSAASIDGAGFLLNNEMDDFSI---------K---------P---------G----------NPNLYGLVGGDANAIEANKRPLSSMSPTIVLK-NNKVF-LVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP---D-EL-RIEKFG-MPADVKDNLTKMGYQIVT--K--PV-MGDVNAIQV------------------------------
42 PsiBlast_CBE 27.7344% -6 - C3 -2QM6 ? B:[1-169] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVADRWGNAVSVTYTINAS-YGSAASIDGAGFLLNNEMDDFSI---------K---------P---------G----------NPNLYGLVGGDANAIEANKRPLSSMSPTIVLK-NNKVF-LVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP---D-EL-RIEKFG-MPADVKDNLTKMGYQIVT--K--PV-MGDVNAIQV------------------------------
43 PsiBlast_CBE 27.6943% -7 - C3 -2QMC ? D:[2-169] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------THYSVADRWGNAVSVTYTINAS-YGSAASIDGAGFLLNNEMDDFSI---------K---------P---------G----------NPNLYGLVGGDANAIEANKRPLSSMSPTIVLK-NNKVF-LVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLP---D-EL-RIEKFG-MPADVKDNLTKMGYQIVT--K--PV-MGDVNAIQV------------------------------
68 HHSearch 27.4534% -6 - C3 -4GDX ? B:[7-195] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TAHLSVVAEDGSAVSATSTIN-LYFGSKVRSPVSGILFNNEMDDFSS---------P---------SITNEFGVPPS----------P----------ANFIQPGKQPLSSMCPTIMVGQDGQVR-MVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLL----PNVT-TVER-N-IDQAVTAALETRHHHTQI--A--STFIAVVQAIVRT----AGGWAAASDSRKGG-EPAGY-----
49 PsiBlast_CBE 27.3340% 8 - C3 -2Z8I ? D:[1-179] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVVDKDGNAVAVTYTLNTT-FGTGIVAGESGILLNNQMDDFSA---------K---------P---------GVPNVYGLVGGD----------ANAVGPNKRPLSSMSPTIVVK-DGKTW-LVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP---D-EL-RVEK-G-FSPDTLKLLEAKGQKVAL--K--EA-MGSTQSIMVG-P--DGELYGASD----------------
70 HHSearch 27.0443% 6 - C3 -2QMC ? B:[1-186] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ATHYSVADRWGNAVSVTYTIN-ASYGSAASIDGAGFLLNNEMDDFSI---------K---------P---------GNPNLYGLVGGD----------ANAIEANKRPLSSMSPTIVLK-NNKVF-LVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWL----PDEL-RIEKFG-MPADVKDNLTKMGYQIVT--K---PVMGDVNAIQVLPKTKGSVFYGSTDPRK-------------
67 HHSearch 26.6242% 11 - C3 -2DG5 ? B:[1-190] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVVDKDGNAVAVTYTLN-TTFGTGIVAGESGILLNNQMDDFSA---------K---------P---------GVPNVYGLVGGD----------ANAVGPNKRPLSSMSPTIVVK-DGKTW-LVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWL----PDEL-RVEK-G-FSPDTLKLLEAKGQKVAL-----KEAMGSTQSIMVG-P--DGELYGASDPRSVDDLTAGY-----
50 PsiBlast_CBE 26.3340% 10 - C3 -2Z8I ? B:[1-179] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVVDKDGNAVAVTYTLNTT-FGTGIVAGESGILLNNQMDDFSA---------K---------P---------GVPNVYGLVGGD----------ANAVGPNKRPLSSMSPTIVVK-DGKTW-LVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP---D-EL-RVEK-G-FSPDTLKLLEAKGQKVAL--K--EA-MGSTQSIMVG-P--DGELYGASD----------------
46 PsiBlast_CBE 26.2240% 10 - C3 -2Z8K ? B:[1-179] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVVDKDGNAVAVTYTLNTT-FGTGIVAGESGILLNNQMDDFSA---------K---------P---------GVPNVYGLVGGD----------ANAVGPNKRPLSSMSPTIVVK-DGKTW-LVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP---D-EL-RVEK-G-FSPDTLKLLEAKGQKVAL--K--EA-MGSTQSIMVG-P--DGELYGASD----------------
45 PsiBlast_CBE 26.2240% 8 - C3 -2Z8K ? D:[1-179] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVVDKDGNAVAVTYTLNTT-FGTGIVAGESGILLNNQMDDFSA---------K---------P---------GVPNVYGLVGGD----------ANAVGPNKRPLSSMSPTIVVK-DGKTW-LVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP---D-EL-RVEK-G-FSPDTLKLLEAKGQKVAL--K--EA-MGSTQSIMVG-P--DGELYGASD----------------
48 PsiBlast_CBE 26.2040% 7 - C3 -2Z8J GGT_ECOLI B:[1-179] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVVDKDGNAVAVTYTLNTT-FGTGIVAGESGILLNNQMDDFSA---------K---------P---------GVPNVYGLVGGD----------ANAVGPNKRPLSSMSPTIVVK-DGKTW-LVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP---D-EL-RVEK-G-FSPDTLKLLEAKGQKVAL--K--EA-MGSTQSIMVG-P--DGELYGASD----------------
47 PsiBlast_CBE 25.8840% 5 - C3 -2Z8J ? D:[1-179] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTHYSVVDKDGNAVAVTYTLNTT-FGTGIVAGESGILLNNQMDDFSA---------K---------P---------GVPNVYGLVGGD----------ANAVGPNKRPLSSMSPTIVVK-DGKTW-LVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLP---D-EL-RVEK-G-FSPDTLKLLEAKGQKVAL--K--EA-MGSTQSIMVG-P--DGELYGASD----------------
52 PsiBlast_CBE 25.7932% -7 - C3 -4ZCG ? B:[1-188] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TAHLSVVAEDGSAVSATSTINLY-FGSKVRSPVSGILFNNEMDDFSS---------PSITNEFGVPP---------S----------P----------ANFIQPGKQPLSSMCPTIMVG-QDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLL----P-NVTTVER-N-IDQAVTAALETRHHHTQI--A--STFIAVVQAIV--RT--AGGWAAASDSRKGG-EPAG------
56 PsiBlast_CBE 25.6432% -4 - C3 -4GG2 ? B:[1-188] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TAHLSVVAEDGSAVSATSTINLY-FGSKVRSPVSGILFNNEMDDFSS---------PSITNEFGVPP---------S----------P----------ANFIQPGKQPLSSMCPTIMVG-QDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLL----P-NVTTVER-N-IDQAVTAALETRHHHTQI--A--STFIAVVQAIV--RT--AGGWAAASDSRKGG-EPAG------
53 PsiBlast_CBE 25.2532% -5 - C3 -4ZC6 ? B:[1-188] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TAHLSVVAEDGSAVSATSTINLY-FGSKVRSPVSGILFNNEMDDFSS---------PSITNEFGVPP---------S----------P----------ANFIQPGKQPLSSMCPTIMVG-QDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLL----P-NVTTVER-N-IDQAVTAALETRHHHTQI--A--STFIAVVQAIV--RT--AGGWAAASDSRKGG-EPAG------