@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu18840: (2016-06-30 )
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW

Atome Classification :

(61 SA) .........10........20........30........40........50........60..--......70....-----.-------...80........90........100.......110......---.---120.-.-.......130.......140.......-150.......160.......170.......180.......190....-...200.......210.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
23 PsiBlast_CBE 86.40100% -32 - C8 -2DCY XYNA_BACSU C:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
3 PsiBlast_PDB 86.32100% -33 - C8 -2DCY XYNA_BACSU A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
25 PsiBlast_CBE 86.2199% -38 - C8 -2Z79 XYNA_BACSU B:[2-185] -----------------------------STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATAGYQSSGSSNVTVW
2 PsiBlast_PDB 86.08100% -33 - C8 -1XXN XYNA_BACSU A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
1 PsiBlast_PDB 86.0099% -27 - C8 -1AXK - GUB_PAEMA (first) A:[155-341] --------------------------SNASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
13 PsiBlast_PDB 85.9899% -32 - C8 -2Z79 XYNA_BACSU A:[2-185] -----------------------------STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATAGYQSSGSSNVTVW
33 PsiBlast_CBE 85.8798% -40 - C8 -1BCX XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATCGYQSSGSSNVTVW
12 PsiBlast_PDB 85.7699% -38 - C8 -2QZ3 XYNA_BACSU A:[2-185] -----------------------------STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATAGYQSSGSSNVTVW
26 PsiBlast_CBE 85.7599% -33 - C8 -2QZ3 XYNA_BACSU B:[2-185] -----------------------------STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATAGYQSSGSSNVTVW
24 PsiBlast_CBE 85.57100% -29 - C8 -2DCY XYNA_BACSU B:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
15 PsiBlast_PDB 85.5698% -33 - C8 -3VZO XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGH--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
6 PsiBlast_PDB 85.5199% -33 - C8 -1XNB XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
22 PsiBlast_CBE 85.38100% -30 - C8 -2DCY XYNA_BACSU E:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
34 PsiBlast_CBE 85.2498% -36 - C8 -2DCZ XYNA_BACSU B:[1-185] ----------------------------ASTDYWHFWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGCSNVTVW
30 PsiBlast_CBE 85.1898% -32 - C8 -3VZN XYNA_BACCI B:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGE--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
5 PsiBlast_PDB 85.1599% -33 - C8 -1BVV XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
9 PsiBlast_PDB 85.0598% -33 - C8 -1HV0 - XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYFVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
35 PsiBlast_CBE 84.9998% -37 - C8 -2DCZ XYNA_BACSU A:[1-185] ----------------------------ASTDYWHFWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGCSNVTVW
29 PsiBlast_CBE 84.9098% -32 - C8 -3VZL XYNA_BACCI B:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGH--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
19 PsiBlast_PDB 84.8898% -34 - C8 -3VZM XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATHGYQSSGSSNVTVW
11 PsiBlast_PDB 84.7498% -31 - C8 -1C5I XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGD--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
17 PsiBlast_PDB 84.7298% -28 - C8 -3VZN XYNA_BACCI A:[1-185] ----------------------------ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGE--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-RTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
37 PsiBlast_CBE 84.4998% -36 - C8 -3EXU XYNA_BACSU A:[1-185] ----------------------------ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-DTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
38 PsiBlast_CBE 84.2398% -28 - C8 -2B46 XYNA_BACSU X:[1-185] ----------------------------ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-DTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
39 PsiBlast_CBE 84.1598% -28 - C8 -2B45 XYNA_BACSU X:[1-185] ----------------------------ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTTRYNAPSIDGD-DTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
118 HHSearch 75.0998% -9 - C8 -2Z79 XYNA_BACSU A:[3-185] ------------------------------TDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T------G-TYKGTVKSDGGTYDIYTTTRYNAPSIDGDRT-TFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATAGYQSSGSSNVTVW
36 PsiBlast_CBE 71.2198% -40 - C8 -3EXU XYNA_BACSU B:[1-185] ----------------------------ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGN--FVVGKGWTTGSP-----F-------RTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRP---T---G--T-Y-KGTVKSDGGTYDIYTTT-------------TFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV-MATEGYQSSGSSNVTVW
40 PsiBlast_CBE 68.0366% -42 - C8 -3ZSE ? A:[14-186] --------------------------------FYSFWTDAPGTVSMELGPGGNYSTSWRNTGN--FVAGKGWATGGR-------------RTVTYSAS-FNPSGNAYLTLYGWTRNPLVEYYIVESWGTYRP---T---G--T-Y-MGTVTTDGGTYDIYKTTRYNAPSIEGT-R-TFDQYWSVRQSKRTSG---TITAGNHFDAWARHGMHLGTH-DYMI-MATEGYQSSGSSNVTL-
41 PsiBlast_CBE 62.0467% -39 - C8 -1M4W ? A:[20-179] ------------------------------------WTDAPGTVSMTLHSGGSYSTSWRNTGN--FVAGKGWSTGGR-------------RTVTYNAS-FNPSGNAYLTLYGWTRNPLVEYYIVESWGTYRP---T---G--T-Y-KGTVTTDGGTYDIYETWRYNAPSIEGT-R-TFQQFWSVRQQKRTSG---TITIGNHFDAWARAGMNLGSH-DYQI-MATEGYQ----------
49 PsiBlast_CBE 61.1555% -11 - C8 -2VUL ? A:[23-214] ----------------AQTCLTSPQTGFHNGFFYSFWKDSPGTVNFCLLEGGRYTSNWSGINN--WVGGKGWQTGSR-------------RNITYSGSFNTP-GNGYLALYGWTTNPLVEYYVVDSWGSWRP---PGSDG--T-F-LGTVNSDGGTYDIYRAQRVNAPSIIGN--ATFYQYWSVRQSKRVGG---TITTGNHFDAWASVGLNLGTH-NYQI-MATEGYQSSGSSDITV-
47 PsiBlast_CBE 60.6756% -8 - C8 -2VGD ? A:[23-214] ----------------AQTCLTSSQTGTNNGFYYSFWKDSPGTVNFCLQSGGRYTSNWSGINN--WVGGKGWQTGSR-------------RNITYSGSFNSP-GNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSD---G--T-F-LGTVNSDGGTYDIYRAQRVNAPSIIGN--ATFYQYWSVRQSKRVGG---TITTGNHFDAWASVGLNLGTH-NYQI-MATEGYQSSGSSDITV-
46 PsiBlast_CBE 60.2956% -2 - C8 -2VUJ ? A:[24-214] -----------------QTCLTSSQTGTNNGFYYSFWKDSPGTVNFCLQSGGRYTSNWSGINN--WVGGKGWQTGSR-------------RNITYSGSFNSP-GNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSD---G--T-F-LGTVNSDGGTYDIYRAQRVNAPSIIGN--ATFYQYWSVRQSKRVGG---TITTGNHFDAWASVGLNLGTH-NYQI-MATEGYQSSGSSDITV-
112 HHSearch 59.4657% -16 - C8 -1XNK ? A:[3-191] --------------------LTSSATGTHNGYYYSFWTDGQGNIRFNLESGGQYSVTWSGNGN--WVGGKGWNPGTD-----N-------RVINYTA-DYRPNGNSYLAVYGWTRNPLIEYYVVESFGTYDP---S---T--GATRMGSVTTDGGTYNIYRTQRVNAPSIEGT-K-TFYQYWSVRTSKR-TG--GTVTMANHFNAWRQAGLQLGS-HDYQI-VATEGYYSSGSATVNVG
76 PsiBlast_CBE 59.3852% -11 - C8 -4HK9 XYN2_HYPJE A:[12-187] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGH--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
73 PsiBlast_CBE 59.3452% -11 - C8 -1RED XYN2_HYPJE B:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
62 PsiBlast_CBE 59.2652% -10 - C8 -3AKT ? B:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
60 PsiBlast_CBE 59.2052% -8 - C8 -4HKW XYN2_HYPJE A:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
71 PsiBlast_CBE 58.9652% -6 - C8 -1REF XYN2_HYPJE B:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
68 PsiBlast_CBE 58.8952% -9 - C8 -3AKP ? A:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
63 PsiBlast_CBE 58.8352% -11 - C8 -3AKT ? A:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
67 PsiBlast_CBE 58.6452% -8 - C8 -3AKP ? B:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
75 PsiBlast_CBE 58.6052% -12 - C8 -4HK8 XYN2_HYPJE A:[13-188] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVQGYFSSGSASITV-
81 PsiBlast_CBE 58.5552% -10 - C8 -4XQW XYN2_HYPJE A:[13-188] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGE--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
64 PsiBlast_CBE 58.5552% -8 - C8 -3AKS ? A:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
72 PsiBlast_CBE 58.3052% -11 - C8 -1REE XYN2_HYPJE B:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
59 PsiBlast_CBE 58.1452% -7 - C8 -4S2D XYN2_HYPJE A:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
65 PsiBlast_CBE 58.1152% -6 - C8 -3AKR ? A:[14-189] --------------------------------FYSYWNDGHGGVTYTNGPGGQFSVNWSNSGN--FVGGKGWQPGTK-----N-------KVINF-SGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNP---STG-A--T-K-LGEVTSDGSVYDIYRTQRVNQPSIIGT--ATFYQYWSVRRNHRSSGS---VNTANHFNAWAQQGLTLGT-MDYQI-VAVEGYFSSGSASITV-
82 PsiBlast_CBE 57.7551% -17 - C8 -1TE1 XYNC_TALFU B:[15-189] --------------------------------YYSFWTNGGGEVTYTNGDNGEYSVTWVDCGD--FTSGKGWNPANA-------------QTVTY-SGEFNPSGNAYLAVYGWTTDPLVEYYILESYGTYNP---S---SGLT-S-LGQVTSDGGTYDIYSTQRVNQPSIEG--TSTFNQYWSVRTEKRVGG---TVTTANHFAAWKALGLEMGT-YNYMI-VSTEGYESSGSSTITV-
91 PsiBlast_CBE 57.5150% 31 - C8 -1H4G ? B:[16-194] ---------------------------------YEFWKDSGGSGTMILNHGGTFSAQWNNVNN--ILFRKGKKFNET-----QTHQQVGNMSINYGAN-FQPNGNAYLCVYGWTVDPLVEYYIVDSWGNWRP---P---GA-T-P-KGTITVDGGTYDIYETLRVNQPSIKG--IATFKQYWSVRRSKRTSG---TISVSNHFRAWENLGMNMGK--MYEVALTVEGYQSSGSANV---
89 PsiBlast_CBE 57.1650% 28 - C8 -1QH6 ? B:[16-194] ---------------------------------YEFWKDSGGSGTMILNHGGTFSAQWNNVNN--ILFRKGKKFNET-----QTHQQVGNMSINYGAN-FQPNGNAYLCVYGWTVDPLVEYYIVDSWGNWRP---P---GA-T-P-KGTITVDGGTYDIYETLRVNQPSIKG--IATFKQYWSVRRSKRTSG---TISVSNHFRAWENLGMNMGK--MYEVALTVEGYQSSGSANV---