@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu19020: (2016-06-30 )
MNDDMVKIIRNGLSASQHPKHILVIGAGMSGLVSASLLKNAGHRVTILEASGRAGGRVCTLRSPFSDDLYFNAGPMRIPNNHSLTLEYIKKFKLPTNVFINRTPMDIIYANGIKTRLQVFERAPGILRYPVAPNEQGKTSEELMLSLLQPILNFINQNPARNWRIVEEQYKNHSLSSFLNTYFSYGAIDMIGVLLDMEAYMGMSLVEVLRESIFFSSPAHFYEITGGMDLLPHAFLPQLKTNILYHQKMMKMSQGENRVTIHCQHQQTAEFTSFTADLAIVTIPFSTLRFVKVEPYHSFSYYKRRAIRELNYISATKIGIEFKSRFWEKAGQHGGKSITDLPIRFSYYPSRNIGANGHAVILASYTWADEALIWDSLSEGERIQYTLLNLSEIYGDIVWSEFVSGTSFSWSQYPYSAGGFTAFEPGQELELYPYIPVPEGRVHFAGEHASLTHAWMQGAIESGIRVAYEVNRLP

Atome Classification :

(22 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......--180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390..---.---....400.......410.......420.......430.......440.......450.......460.......470..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNDDMVKIIRNGLSASQHPKHILVIGAGMSGLVSASLLKNAGHRVTILEASGRAGGRVCTLRSPFSDDLYFNAGPMRIPNNHSLTLEYIKKFKLPTNVFINRTPMDIIYANGIKTRLQVFERAPGILRYPVAPNEQGKTSEELMLSLLQPILNFINQNPARNWRIVEEQYKNHSLSSFL--NTYFSYGAIDMIGVLLDMEAYMGMSLVEVLRESIFFSSPAHFYEITGGMDLLPHAFLPQLKTNILYHQKMMKMSQGENRVTIHCQHQQTAEFTSFTADLAIVTIPFSTLRFVKVEPYHSFSYYKRRAIRELNYISATKIGIEFKSRFWEKAGQHGGKSITDLPIRFSYYPSRNIGANGHAVILASYTWADEALIWDSLSEGERIQYTLLNLSEIY---G---DIVWSEFVSGTSFSWSQYPYSAGGFTAFEPGQELELYPYIPVPEGRVHFAGEHASLTHAWMQGAIESGIRVAYEVNRLP
22 PsiBlast_CBE 81.6336% -33 - C4 -3KVE OXLA_VIPAA C:[17-482] --EEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNS-KEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRT---NCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEK-DTSSNTADYVIVCTTSRAARRIQFEP--PLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-STGVGVIIA-YGIGDDANFFQALKFKDCADIVFNDLSLIHQLPK---EEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNR--
1 PsiBlast_PDB 80.6136% -32 * C4 *1REO OXLA_GLOHA A:[17-482] --EEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRND-KEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQ-TPAKEMASVTADYVIVCTTSRATRRIKFEP--PLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNF-TSGVGVIIA-YGIGDDANFFQALDFKDCADIVINDLSLIH---QLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNR--
23 PsiBlast_CBE 80.5236% -35 - C4 -3KVE OXLA_VIPAA B:[17-482] --EEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNS-KEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRT---NCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEK-DTSSNTADYVIVCTTSRAARRIQFEP--PLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-STGVGVIIA-YGIGDDANFFQALKFKDCADIVFNDLSLIHQLPK---EEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNR--
5 PsiBlast_PDB 80.2036% -35 - C4 -3KVE OXLA_VIPAA A:[17-482] --EEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNS-KEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRT---NCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEK-DTSSNTADYVIVCTTSRAARRIQFEP--PLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-STGVGVIIA-YGIGDDANFFQALKFKDCADIVFNDLSLIHQLPK---EEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNR--
3 PsiBlast_PDB 80.1736% -33 - C4 -1TDN OXLA_GLOHA A:[17-482] --EEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRND-KEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQ-TPAKEMASVTADYVIVCTTSRATRRIKFEP--PLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNF-TSGVGVIIA-YGIGDDANFFQALDFKDCADIVINDLSLIH---QLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNR--
2 PsiBlast_PDB 80.0336% -33 - C4 -1TDK OXLA_GLOHA A:[17-482] --EEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRND-KEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQ-TPAKEMASVTADYVIVCTTSRATRRIKFEP--PLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNF-TSGVGVIIA-YGIGDDANFFQALDFKDCADIVINDLSLIH---QLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNR--
21 PsiBlast_CBE 79.3436% -33 - C4 -3KVE OXLA_VIPAA D:[17-482] --EEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNS-KEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRT---NCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEK-DTSSNTADYVIVCTTSRAARRIQFEP--PLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-STGVGVIIA-YGIGDDANFFQALKFKDCADIVFNDLSLIHQLPK---EEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNR--
4 PsiBlast_PDB 79.2436% -31 - C4 -1TDO OXLA_GLOHA A:[17-482] --EEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRND-KEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQ-TPAKEMASVTADYVIVCTTSRATRRIKFEP--PLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNF-TSGVGVIIA-YGIGDDANFFQALDFKDCADIVINDLSLIH---QLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNR--
8 PsiBlast_PDB 77.9735% -36 - C4 -2IID OXLA_CALRH A:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---
25 PsiBlast_CBE 77.7935% -37 - C4 -2IID OXLA_CALRH C:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---
34 PsiBlast_CBE 77.5235% -34 - C4 -1F8R OXLA_CALRH D:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---
29 PsiBlast_CBE 77.4435% -33 - C4 -1F8S OXLA_CALRH F:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---
28 PsiBlast_CBE 77.4035% -35 - C4 -1F8S OXLA_CALRH G:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---
24 PsiBlast_CBE 77.3035% -36 - C4 -2IID OXLA_CALRH D:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---
26 PsiBlast_CBE 77.1635% -34 - C4 -2IID OXLA_CALRH B:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---
33 PsiBlast_CBE 77.1435% -33 - C4 -1F8S OXLA_CALRH B:[17-481] --EEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEA-GWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRT---NCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTV-VYETLSKETPSVTADYVIVCTTSRAVRLIKFNP--PLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNF-TNGVGVIIA-YGIGDDANFFQALDFKDCADIVFNDLSLIHQLPK---KDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVN---