@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu19630: (2016-07-01 )
MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIEVALHSVSQ

Atome Classification :

(59 SA) .........10........20........30........40........50........60........70........80........90........100.......110....-...120.-......130.......140.......150.......160-.-...-...170.......180.......190.......--200.....-.-.210.....---...220.......230.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIEVALHSVSQ
4 PsiBlast_PDB 94.4499%-111 - C3 -4D98 DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
25 PsiBlast_CBE 94.2699%-110 - C3 -4D8Y DEOD_BACSU F:[21-252] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
10 PsiBlast_PDB 94.1999%-113 - C3 -4DAB DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
7 PsiBlast_PDB 94.1199%-113 - C3 -4DA6 DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
29 PsiBlast_CBE 94.0899%-113 - C3 -4D8Y DEOD_BACSU B:[21-252] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
13 PsiBlast_PDB 93.9699%-117 - C3 -4DAO DEOD_BACSU A:[22-251] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSV--
8 PsiBlast_PDB 93.9599%-113 - C3 -4DA7 DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
28 PsiBlast_CBE 93.9399%-114 - C3 -4D8Y DEOD_BACSU C:[21-252] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
12 PsiBlast_PDB 93.7499%-114 - C3 -4DAN DEOD_BACSU A:[22-250] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHS---
30 PsiBlast_CBE 93.6299%-112 - C3 -4D8V DEOD_BACSU B:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
5 PsiBlast_PDB 93.6299%-113 - C3 -4D9H DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
26 PsiBlast_CBE 93.5599%-115 - C3 -4D8Y DEOD_BACSU E:[21-252] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
14 PsiBlast_PDB 93.3699%-116 - C3 -4DAR DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
11 PsiBlast_PDB 93.3699%-112 - C3 -4DAE DEOD_BACSU A:[21-252] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
21 PsiBlast_CBE 93.2699%-110 - C3 -4DAO DEOD_BACSU B:[22-251] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSV--
22 PsiBlast_CBE 93.2499%-115 - C3 -4DAN DEOD_BACSU B:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
2 PsiBlast_PDB 92.9199%-116 - C- -4D8X - DEOD_BACSU A:[2-232] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
27 PsiBlast_CBE 92.7099%-112 - C3 -4D8Y DEOD_BACSU D:[21-252] MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
1 PsiBlast_PDB 92.6199%-109 - C3 -4D8V DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
24 PsiBlast_CBE 92.1599%-109 - C3 -4D98 DEOD_BACSU B:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
9 PsiBlast_PDB 92.0499%-113 - C3 -4DA8 DEOD_BACSU A:[22-252] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSVS-
6 PsiBlast_PDB 91.3999%-109 - C3 -4DA0 DEOD_BACSU A:[22-251] -SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMN-RVAFGSV-DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYND-D-SQI-EKLAKYGVLGVEMETTALYTLAAKHGRKALSIL--TVSDHVLT-G-EE-TTAEER---QTTFHDMIDVALHSV--
17 PsiBlast_PDB 84.2371% -96 - C3 -3UAY DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMN-RLTFPGF-DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMV-KKLGDYGVLAVEMETTALYTLAAKYGVNALSVL--TVSNHIFT-G-EE-TTSEER---QTTFNEMIEIALDAAIQ
18 PsiBlast_PDB 83.4871% -96 - C3 -3UAZ DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMN-RLTFPGF-DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMV-KKLGDYGVLAVEMETTALYTLAAKYGVNALSVL--TVSNHIFT-G-EE-TTSEER---QTTFNEMIEIALDAAIQ
16 PsiBlast_PDB 82.9271% -92 - C3 -3UAW DEOD_BACCE A:[2-234] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMN-RLTFPGF-DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMV-KKLGDYGVLAVEMETTALYTLAAKYGVNALSVL--TVSDHIFT-G-EE-TTSEER---QTTFNEMIEIALDAAIQ
15 PsiBlast_PDB 82.0071%-102 - C3 -2AC7 DEOD_BACAN A:[2-232] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMN-RLTFPGF-DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMV-KKLGDYGVLAVEMETTALYTLAAKYGVNALSVL--TVSDHI-----------------QTTFNEMIEIALDAA--
31 PsiBlast_CBE 81.8471%-102 - C3 -2AC7 DEOD_BACAN B:[2-232] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMN-RLTFPGF-DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRE-SMDMV-KKLGDYGVLAVEMETTALYTLAAKYGVNALSVL--TVSDHIF----------------QTTFNEMIEIALDAA--
110 HHSearch 81.2170% -86 - C3 -3UAW DEOD_BACCE A:[2-233] -SVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMN-RLTFPGF-DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESM-DMV-KKLGDYGVLAVEMETTALYTLAAKYGVNALSVL--TVSDHIFTGE-ET-TSEER----QTTFNEMIEIALDAAI-
75 PsiBlast_CBE 80.9458%-103 - C3 -3UT6 DEOD_ECOLI C:[4-232] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVN-RIRFKDH-DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTIC--TVSDHIRT-H-EQ-TTAAER---QTTFNDMIKIALESV--
45 PsiBlast_CBE 80.8858%-103 - C3 -1PR6 DEOD_ECO57 C:[5-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVN-RIRFKDH-DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSP-D-GEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTIC--TVSDHIRT-H-EQ-T--------QTTFNDMIKIALESV--
58 PsiBlast_CBE 80.4558%-109 - C3 -1PR1 DEOD_ECO57 B:[5-233] ---HINAEMGDFADVVLMPGDPLRAKYIAETFL<