@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu19740: (2016-07-01 )
MSSYLIKPELSSAYPVVSYAKGSYVYDQTGKKYLDGSSGAVTCNIGHGVRDVTEKLKEQLDQVSFAYRSQFTSEPAEQLAALLAQELPGDVNWSFFVNSGSEAIETAMKIAIQYWQEKKQTQKSIFLSRWSSYHGITLGALSLSGFYERRYRFTHLIERYPAISAPHIYRLNHETEEDFVQTAADELDTMIKRIGSQFIAGFVAEPIIGAAGAAITPPPGYYERLSEVCRTHDVLFIADEVMTGLGRTGRMLATEHWDTVPDIAVLGKGLGAGYAPIAAAVVSDSIIETIKQGSGVIMSGHTYSAHPYSAKAALEVLRYVLKHGLIKQSEKKGAVLKKKLDEAASQSGIIGEVRGKGLLLGIEFVADQKTKKVFPPEQAITQLIVSEAKKRGLIVYPSKAGIDSGEGDAVIIAPPFTISDGEMEELISIFSETVAAVEKNLKKD

Atome Classification :

(29 SA) .........10........20........30........40........50........60......-..-70-......-..80........90........100.......110.......120.......130.......140.......150..--.....160.......170...-...-..180.......190.......200.......210.......220.......230.......240.......250...-.-...260.......270.-......280.......290---..---..---....300.......310.......320......-.330........340.......350.......360.......370.-------.....-----------------.380.......390.......400.......410.......420.......430.......440..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSSYLIKPELSSAYPVVSYAKGSYVYDQTGKKYLDGSSGAVTCNIGHGVRDVTEKLKEQLDQVSFAY-RS-QF-TSEPAE-QLAALLAQELPGDVNWSFFVNSGSEAIETAMKIAIQYWQEKKQTQKSIFLSRWSSYHGITLGALSLSGFYERRYRFT--HLIERYPAISAPHIYRL-NHE-TEE-DFVQTAADELDTMIKRIGSQFIAGFVAEPIIGAAGAAITPPPGYYERLSEVCRTHDVLFIADEVMTGLGRTGRMLATE-H-WDTVPDIAVLGKGLGAG-YAPIAAAVVSDSIIETIK----QG---SG---VIMSGHTYSAHPYSAKAALEVLRYVLKHGLIKQ-SE-KKGAVLKKKLDEAASQSGIIGEVRGKGLLLGIEFVADQKTKKV-------FPPEQ-----------------AITQLIVSEAKKRGLIVYPSKAGIDSGEGDAVIIAPPFTISDGEMEELISIFSETVAAVEKNLKKD
10 PsiBlast_PDB 80.9129% -59 - C1 -3I5T ? A:[35-454] -----------SAQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYAS-PW-YM-ATSPAA-RLAEKIATLTPGDLNRIFFTTGGSTAVDSALRFSEFYNNVLGRPQKKRIIVRYDGYHGSTALTAACTGRTGNWPNFD--IAQDRISFLSSPNPRHA-GNR-SQE-AFLDDLVQEFEDRIESLGPDTIAAFLAEPIL-ASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASE-KVFGVVPDIITFAKGVTSG-YVPLGGLAISEAVLARISGENAKG---S----WFTNGYTYSNQPVACAAALANIELMEREGIVDQ-AR-EMADYFAAALASLRDLPG-VAETRSVGLVGCVQCLLD-----G-------TAEDK-----------------AFTLKIDERCFELGLIVRPL--------GDLCVISPPLIISRAQIDEMVAIMRQAITEV-------
70 HHSearch 80.7029% -52 - C1 -3I5T ? A:[36-457] ------------AQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYAS-PW-YM-ATSPAA-RLAEKIATLTPGDLNRIFFTTGGSTAVDSALRFSEFYNNVLGRPQKKRIIVRYDGYHGSTALTAACTGRTGNWPNFD--IAQDRISFLSSPNPRHA-GNR-SQE-AFLDDLVQEFEDRIESLGPDTIAAFLAEPILAS-GGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKV-FGVVPDIITFAKGVTSGYV-PLGGLAISEAVLARIS----GENAKGS---WFTNGYTYSNQPVACAAALANIELMEREGIVDQ-AR-EMADYFAAALASLRD-LPGVAETRSVGLVGCVQCLLD-----G-------TAEDK-----------------AFTLKIDERCFELGLIVR--PLG------DLCVISPPLIISRAQIDEMVAIMRQAITEVSAA----
32 PsiBlast_CBE 78.9831% -19 - C1 -4A6T ? C:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
27 PsiBlast_CBE 78.8731% -19 - C1 -4AH3 ? C:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
31 PsiBlast_CBE 78.4331% -19 - C1 -4A6T ? D:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
29 PsiBlast_CBE 78.3531% -19 - C1 -4A72 ? D:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
6 PsiBlast_PDB 78.2531% -18 - C1 -4AH3 ? A:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
8 PsiBlast_PDB 78.1731% -19 - C1 -4BA5 ? A:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
33 PsiBlast_CBE 78.0231% -18 - C1 -4A6T ? B:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
3 PsiBlast_PDB 77.5631% -21 - C1 -4A6R ? A:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMH---D--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
7 PsiBlast_PDB 77.4831% -22 - C1 -4BA4 - ? A:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
24 PsiBlast_CBE 77.4331% -17 - C1 -4BA5 ? B:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
4 PsiBlast_PDB 77.2431% -17 - C1 -4A6T ? A:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
28 PsiBlast_CBE 77.0331% -20 - C1 -4AH3 ? B:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
25 PsiBlast_CBE 76.9831% -22 - C1 -4BA4 ? B:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
26 PsiBlast_CBE 76.6731% -18 - C1 -4AH3 ? D:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGD--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
34 PsiBlast_CBE 76.4131% -22 - C1 -4A6R ? B:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMH------LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
30 PsiBlast_CBE 76.0231% -19 - C1 -4A72 ? C:[35-454] ---------------VMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPF-Y-NT-FFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQ-D--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGV-IVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSG-YLPIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKD-DIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMRAC--------GDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLK--
77 HHSearch 75.8030% -23 - C1 -4A6R ? A:[34-453] --------------RVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYN-TFFKT-THPAVV-ELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMH---D--LPIPGMAHIEQPWWYKH-GKDMTPD-EFGVVAARWLEEKILEIGADKVAAFVGEPIQGA-GGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ-H-FGFQPDLFTAAKGLSSGYL-PIGAVFVGKRVAEGLI----AG----G---DFNHGFTYSGHPVCAAVAHANVAALRDEGIVQR-VKDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREL-------FPDFG-----------------EIGTLCRDIFFRNNLIMR--ACG------DHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTL---
9 PsiBlast_PDB 75.6534% -30 - C1 -3N5M ? A:[25-442] ------RPFSPNSTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQTLSYFP-MS-Q--SHEPAI-KLAEKLNEWLGGEY-VIFFSNSGSEANETAFKIARQYYAQKGEPHRYKFMSRYRGYHGNTMATMAATGQAQRRYQYE--PFASGFLHVTPPDCYRMPGIE-REN-IYDVECVKEVDRVMTWELSETIAAFIMEPII-TGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKAFGFM-N-YDVKPDIITMAKGITSA-YLPLSATAVKREIYEAFK-----G---KGEYEFFRHINTFGGNPAACALALKNLEIIENENLIER-SA-QMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGIELVNDKETKE---------PIDN-----------------DKIASVVNACKEKGLII-GRNGMTTAGYNNILTLAPPLVISSEEIAFVI-----------------
83 HHSearch 68.1431% -18 - C1 -4PPM ? A:[414-852] -----------RCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPNFIQY-IS-IPEQTA-KLAEVLCRLAPGNMGRVFFSNSGTEAVEAAMKIAKAST------GKPGIAYLRNSYHGKTLGALSITGRDKHRRYFT--PLLDAMVEVPF-------------------GDLAALREALNR---EDVGALMIEPIQGE-GGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKLFACE-W-DGIEPDVLMLSKSLSGG-LIPIGATLCRADLWQKAY----GTA--DR---FLVHSSTYGGGNLASVVALSALREILAQDLVGH-AE-RMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQFDQA------HTTWKFLPDPVQAHLRAAMDRMEQALGEMFCMKFVTKLCQDHKILTF--ITAN---SSTVIRIQPPLIISKAEIDRFVGAFATVCEELSTFL---
60 PsiBlast_CBE 43.3433% -47 - C1 -1MGV BIOA_ECOLI B:[27-314] -------------YPVVS-AEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVM-FG-GI-THAPAI-ELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKGEARQR-FLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFA-PAPQ-SRM-DGE-WDERDMVGFAR------LMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACE-H-AEIAPDILCLGKALTGG-TMTLSATLTTREVAETIS----NGE--AG---CFMHGPTFMGNP-------------------------------------------------------------------------------------------------------------------------------------------------------------------
57 PsiBlast_CBE 43.0933% -65 - C1 -1QJ3 BIOA_ECOLI B:[27-314] -------------YPVVS-AEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVM-FG-GI-THAPAI-ELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKGEARQR-FLTFRNGYHGDTFGAMSVCDPDN---------LPENLFA-PAPQ-SRM---E-WDERDMVGFAR------LMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACE-H-AEIAPDILCLGKALTGG-TMTLSATLTTREVAETIS----NG----G---CFMHGPTFMGNP-------------------------------------------------------------------------------------------------------------------------------------------------------------------
62 PsiBlast_CBE 42.1532% -49 - C1 -1S07 BIOA_ECOLI B:[27-314] -------------YPVVS-AEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVM-FG-GI-THAPAI-ELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKGEARQR-FLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFA-PAPQ-SRM-DGE-WDERDMVGFAR------LMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGATGKLFACE-H-AEIAPDILCLGKALTGG-TMTLSATLTTREVAETIS----NGE--AG---CFMHGPTFMGNP-------------------------------------------------------------------------------------------------------------------------------------------------------------------
58 PsiBlast_CBE 42.1233% -46 - C1 -1MLZ BIOA_ECOLI B:[27-314] -------------YPVVS-AEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVM-FG-GI-THAPAI-ELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKGEARQR-FLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFA-PAPQ-SRM-DGE-WDERDMVGFAR------LMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACE-H-AEIAPDILCLGKALTGG-TMTLSATLTTREVAETIS----NGE--AG---CFMHGPTFMGNP-------------------------------------------------------------------------------------------------------------------------------------------------------------------
63 PsiBlast_CBE 42.0332% -49 - C1 -1S07 BIOA_ECOLI A:[27-314] -------------YPVVS-AEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVM-FG-GI-THAPAI-ELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKGEARQR-FLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFA-PAPQ-SRM-DGE-WDERDMVGFAR------LMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGATGKLFACE-H-AEIAPDILCLGKALTGG-TMTLSATLTTREVAETIS----NGE--AG---CFMHGPTFMGNP-------------------------------------------------------------------------------------------------------------------------------------------------------------------