@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu21610: (2016-07-03 )
MKKVLLGFAAFTLSLSLAACSSNDSEKVSTEKETPQASTDVEKKTEQKESTKEKTADKSKEKDKKELVDVTLDRAVDGDTIKVTYNGNVDTVRYLLIDTPETKKPNSCVQPYGEDASKRNKELVNSGKLQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGLARVAYVYEPNTKYIDQFKKDEQEAKSEKLSIWSKNGYVTDRGFNGCVKEKTTAVKKATTSKPAATQPTTPKASSETSTTTEKEASSETTGGTETFKNCTELRKKYPNGVPSSHPAYQSKMDRDHDNYACER

Atome Classification :

(77 SA) .........10........20........30........40........50........60........70........80..-......90.....-...100.......110.......120.-.-...-.-.130.......140.......150.......160.......170.......180.-......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKKVLLGFAAFTLSLSLAACSSNDSEKVSTEKETPQASTDVEKKTEQKESTKEKTADKSKEKDKKELVDVTLDRAVDGDTIKV-TYNGNVDTVRYLL-IDTPETKKPNSCVQPYGEDASKRNKEL-V-NSG-K-LQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGLARVAYVYEPNTKYIDQFK-KDEQEAKSEKLSIWSKNGYVTDRGFNGCVKEKTTAVKKATTSKPAATQPTTPKASSETSTTTEKEASSETTGGTETFKNCTELRKKYPNGVPSSHPAYQSKMDRDHDNYACER
151 Fugue 71.9847% 15 - C9 -1JOR - NUC_STAAU A:[1-149] ----------------------------------------------------------ATSTKKLHKEPATLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-V-ENA-KKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLR-KSEAQAKKEKLNIWSEDNADSGQ------------------------------------------------------------------------------------------
58 PsiBlast_CBE 69.7750% 27 - C9 -5EKL NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFDKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
37 PsiBlast_CBE 69.2653% 32 - C9 -2SNM NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-KENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
30 PsiBlast_CBE 69.2354% 18 - C9 -1JOK NUC_STAAU A:[13-143] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLR-KSEAQAKKEKLNIWSED------------------------------------------------------------------------------------------------
45 PsiBlast_CBE 68.4252% 34 - C9 -2PZT NUC_STAAW A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETK-----VEKYGPEASAFTKKM-QENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 68.1854% 29 - C9 -4K5X NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTMKL-MYKGQPMTFRFLL-VDTPETKHP---VEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
51 PsiBlast_CBE 68.0750% 2 - C9 -3U9O NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGNTVKL-MYKGQPMVFRLLL-VDIP-----------YGPEAAAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVGEALVRQGLAKVAYVYKGNNTHEQHLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
79 PsiBlast_CBE 67.7050% 14 - C9 -5DEH NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVDEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 67.6054% 34 - C9 -1KDA - NUC_STAAU A:[13-142] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYDPNNTHEQHLR-KSEAQAKKEKLNIWSE-------------------------------------------------------------------------------------------------
38 PsiBlast_CBE 67.5753% 34 - C9 -1SYF NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKTNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
32 PsiBlast_CBE 67.5654% 20 - C9 -4K5W NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTMKF-MYKGQPMTFRLLL-VDTPETKHP---VEKYGPEASAFFKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
41 PsiBlast_CBE 67.4853% 38 - C9 -1STY NUC_STAAU A:[13-142] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRGKSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 67.4254% 30 - C9 -4QF4 NUC_STAAU B:[13-141] ----------------------------------------------------------------------TLIKAIDGDTMKL-MYKGQPMTFRLLL-VDTPETKHP---VEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
22 PsiBlast_CBE 67.4054% 28 - C9 -4KD4 NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTLKV-MYKGQPMTFRLLL-VDTPETKHP---VEKYGPEASAFTKKM-IENAK-K-VEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
33 PsiBlast_CBE 67.3253% 28 - C9 -1SNM NUC_STAAU A:[13-142] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPDTKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWSE-------------------------------------------------------------------------------------------------
94 PsiBlast_CBE 67.2950% 30 - C9 -5C5M NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFDKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 67.2854% 35 - C9 -4QF4 NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTMKL-MYKGQPMTFRLLL-VDTPETKHP---VEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
48 PsiBlast_CBE 67.2452% 29 - C9 -2OXP NUC_STAAW A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPET------VEKYGPEASAFTKKMDE-NAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
31 PsiBlast_CBE 67.1953% 31 - C9 -1ENC NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGETVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 67.1954% 31 - C9 -4WOR NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 67.1953% 25 - C9 -4ODG NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTIKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-IENAK-K-IEIEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
100 PsiBlast_CBE 67.1250% 22 - C9 -4J6H NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTQEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
76 PsiBlast_CBE 67.1050% 18 - C9 -4KV6 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLQ-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 67.0252% 36 - C9 -1STA NUC_STAAU A:[7-143] --------------------------------------------------------------LHKEPGGATLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
28 PsiBlast_CBE 66.8454% 14 - C9 -4K6D NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTMKL-MYKGQPMTFRLLL-VDTP-----------YGPEASAFFKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
98 PsiBlast_CBE 66.8149% 14 * C9 *3NQT NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-AENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
42 PsiBlast_CBE 66.7753% 50 - C9 -1STB NUC_STAAU A:[13-142] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLLLVDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
35 PsiBlast_CBE 66.7254% 26 - C9 -2ENB NUC_STAAU A:[7-135] ----------------------------------------------------------------------TLIKAIDGETVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 66.6555% 26 - C9 -4R8N NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTIKL-MYKGQPMTFRLLL-VDTPETKHP---VEKYGPEASAFTKKM-IENAK-K-VEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
39 PsiBlast_CBE 66.6453% 31 - C9 -1SYD NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 66.6254% 25 - C9 -1STG NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
82 PsiBlast_CBE 66.4349% 14 - C9 -4DF7 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTLKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
44 PsiBlast_CBE 66.3954% 31 - C9 -1A2T NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTCKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
67 PsiBlast_CBE 66.3750% 14 - C9 -3BDC NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
90 PsiBlast_CBE 66.3650% 22 - C9 -5C4Z NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKH-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 66.3554% 33 - C9 -1SNC NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
84 PsiBlast_CBE 66.3350% 30 - C9 -3TP8 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRELL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
29 PsiBlast_CBE 66.2954% 36 - C9 -1JOQ NUC_STAAU A:[13-143] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLR-KSEAQAKKEKLNIWSED------------------------------------------------------------------------------------------------
49 PsiBlast_CBE 66.2052% 38 - C9 -3D6C NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLE-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
97 PsiBlast_CBE 66.1450% 23 - C9 -4DFA NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRALL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 66.1254% 29 - C9 -1STH NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
86 PsiBlast_CBE 66.1050% 20 - C9 -3NXW NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLAR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
87 PsiBlast_CBE 66.0350% 35 - C9 -5C6A NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKE-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
95 PsiBlast_CBE 65.9150% 24 - C9 -3PMF NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTAKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
99 PsiBlast_CBE 65.8550% 18 - C9 -4PNY NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-HEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
70 PsiBlast_CBE 65.7950% 37 - C9 -3HEJ NUC_STAAU B:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFRKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
101 HHSearch 65.7649% 7 - C9 -4EQP NUC_STAAU A:[7-135] ----------------------------------------------------------------LHKEPATLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-V-ENAKK-DEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
85 PsiBlast_CBE 65.7350% 16 - C9 -3NK9 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEAEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
57 PsiBlast_CBE 65.7351% 18 - C9 -4F8M NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTIKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
72 PsiBlast_CBE 65.6250% 18 - C9 -4IZ8 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
43 PsiBlast_CBE 65.6153% 25 - C9 -3DMU NUC_STAAU A:[13-141] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTP---------EKYGPEASAFKKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
74 PsiBlast_CBE 65.5550% 16 - C9 -3MXP NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFAKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
64 PsiBlast_CBE 65.5150% 21 - C9 -3S9W NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
78 PsiBlast_CBE 65.5050% 21 - C9 -3OSO NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKA-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
96 PsiBlast_CBE 65.3649% 24 - C9 -3LX0 NUC_STAAU A:[13-136] ----------------------------------------------------------------------TLIKAIDGNTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWSE-------------------------------------------------------------------------------------------------
92 PsiBlast_CBE 65.3250% 21 - C9 -4ZQ3 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYTYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
59 PsiBlast_CBE 65.3150% 18 - C9 -5I9P ? A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFHKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
75 PsiBlast_CBE 65.2750% 26 - C9 -3NP8 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRALL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
68 PsiBlast_CBE 65.2250% 38 - C9 -3HEJ NUC_STAAU D:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFRKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
71 PsiBlast_CBE 65.1750% 35 - C9 -3HEJ NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFRKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
77 PsiBlast_CBE 65.1650% 21 - C9 -4KTA NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVQQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
91 PsiBlast_CBE 65.0749% 16 - C9 -4ZUJ NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAHIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
56 PsiBlast_CBE 65.0650% 21 - C9 -4LAA NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRHLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
73 PsiBlast_CBE 65.0350% 23 - C9 -3R3O NUC_STAAW A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFAKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
65 PsiBlast_CBE 64.9750% 21 - C9 -5IIF ? A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFDKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
69 PsiBlast_CBE 64.9650% 35 - C9 -3HEJ NUC_STAAU C:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFRKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
61 PsiBlast_CBE 64.9650% 21 - C9 -3T13 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-V-ENG-KKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
81 PsiBlast_CBE 64.9550% 23 - C9 -4IUN NUC_STAAU A:[13-136] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLE-KAEAQAKKEKLNIWSE-------------------------------------------------------------------------------------------------
93 PsiBlast_CBE 64.8850% 23 - C9 -4HMJ NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRDLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
40 PsiBlast_CBE 64.8253% 70 - C9 -1SYB NUC_STAAU A:[13-142] ----------------------------------------------------------------------TLIKAIDGDTVKLMSSNGSPMTFRLLL-VDTPETKHPKKGVEKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR-KSEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
62 PsiBlast_CBE 64.8150% 19 - C9 -3SR1 NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-V-ENG-KKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
66 PsiBlast_CBE 64.7950% 24 - C9 -3MVV NUC_STAAW A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTARLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------
80 PsiBlast_CBE 64.7550% 17 - C9 -4J1M NUC_STAAU A:[13-135] ----------------------------------------------------------------------TLIKAIDGDTVKL-MYKGQPMTFRLLL-VDTPEFN------EKYGPEASAFTKKM-VENAK-K-IEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVEQGLAKVAYVYKGNNTHEQLLR-KAEAQAKKEKLNIWS--------------------------------------------------------------------------------------------------