@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu22550: (2016-07-04 )
MLNKIYDWVDERLDITPMWRDIADHEVPEHVNPAHHFSAFVYCFGGLTFFVTVIQVLSGMFLTMYYVPDIKNAWESVYYLQNEVAFGQIVRGMHHWGASLVIVMMFLHTLRVFFQGAYKKPRELNWIVGVLIFFVMLGLGFTGYLLPWDMKALFATKVGLQIAEATPLIGTQVKTLLAGHPDIVGAQTLTRFFAIHVFFLPAALFGLMAAHFIMIRKQGISGPL

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLNKIYDWVDERLDITPMWRDIADHEVPEHVNPAHHFSAFVYCFGGLTFFVTVIQVLSGMFLTMYYVPDIKNAWESVYYLQNEVAFGQIVRGMHHWGASLVIVMMFLHTLRVFFQGAYKKPRELNWIVGVLIFFVMLGLGFTGYLLPWDMKALFATKVGLQIAEATPLIGTQVKTLLAGHPDIVGAQTLTRFFAIHVFFLPAALFGLMAAHFIMIRKQGISGPL
22 PsiBlast_CBE 89.7143% 0 - C- -1VF5 CYB6_MASLA N:[13-214] -------------EIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGP-
21 PsiBlast_CBE 89.7143% 0 - C- -2D2C CYB6_MASLA N:[13-214] -------------EIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGP-
2 PsiBlast_PDB 89.7143% 0 - C- -2D2C CYB6_MASLA A:[13-214] -------------EIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGP-
1 PsiBlast_PDB 89.7143% 0 - C- -1VF5 CYB6_MASLA A:[13-214] -------------EIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGP-
6 PsiBlast_PDB 88.3643%-172 - C8 -4H0L CYB6_MASLA A:[3-215] ---NVYDWFQERLEIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
11 PsiBlast_PDB 87.4343%-168 - C8 -4H44 CYB6_NOSS1 A:[1-215] -MANVYDWFEERLEIQAIAEDVTSKYVPPHVN-------IFYCLGGITLVCFLIQFATGFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL
8 PsiBlast_PDB 86.5943%-170 - C8 -4I7Z CYB6_MASLA A:[3-215] ---NVYDWFQERLEIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
3 PsiBlast_PDB 86.5543%-169 - C8 -2E74 CYB6_MASLA A:[1-215] -MANVYDWFQERLEIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
7 PsiBlast_PDB 86.5143%-165 - C8 -4H13 CYB6_MASLA A:[1-215] -MANVYDWFQERLEIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
9 PsiBlast_PDB 86.4343%-174 - C8 -4PV1 CYB6_MASLA A:[3-215] ---NVYDWFQERLEIQALADDVTSKYVPPHVN-------IFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
99 HHSearch 86.1844%-169 - C8 -4OGQ CYB6_NOSS1 A:[2-215] --ANVYDWFEERLEIQAIAEDVTSKYVPP-----HV--NIFYCLGGITLVCFLIQFATGFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGG-SSVGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL
13 PsiBlast_PDB 85.7643%-166 - C8 -1Q90 CYB6_CHLRE B:[4-215] ----VYDWFEERLEIQAIADDITSKYVPPHVN-------IFYCIGGITFTCFLVQVATGFAMTFYYRPTVAEAFASVQYIMTDVNFGWLIRSIHRWSASMMVLMMVLHVFRVYLTGGFKRPRELTWVTGVIMAVCTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPGVGGFIVELLRGGVG-VGQATLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
12 PsiBlast_PDB 85.1343%-168 - C8 -4OGQ CYB6_NOSS1 A:[2-215] --ANVYDWFEERLEIQAIAEDVTSKYVPPHVN-------IFYCLGGITLVCFLIQFATGFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL
10 PsiBlast_PDB 85.0143%-169 - C8 -2ZT9 CYB6_NOSS1 A:[1-215] -MANVYDWFEERLEIQAIAEDVTSKYVPPHVN-------IFYCLGGITLVCFLIQFATGFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSS-VGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL