@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu22600: (2016-07-05 )
MKRDKVQTLHGEIHIPGDKSISHRSVMFGALAAGTTTVKNFLPGADCLSTIDCFRKMGVHIEQSSSDVVIHGKGIDALKEPESLLDVGNSGTTIRLMLGILAGRPFYSAVAGDESIAKRPMKRVTEPLKKMGAKIDGRAGGEFTPLSVSGASLKGIDYVSPVASAQIKSAVLLAGLQAEGTTTVTEPHKSRDHTERMLSAFGVKLSEDQTSVSIAGGQKLTAADIFVPGDISSAAFFLAAGAMVPNSRIVLKNVGLNPTRTGIIDVLQNMGAKLEIKPSADSGAEPYGDLIIETSSLKAVEIGGDIIPRLIDEIPIIALLATQAEGTTVIKDAAELKVKETNRIDTVVSELRKLGAEIEPTADGMKVYGKQTLKGGAAVSSHGDHRIGMMLGIASCITEEPIEIEHTDAIHVSYPTFFEHLNKLSKKS

Atome Classification :

(28 SA) ....-.....10........20........30........40........50........60.--.-......70........80........90........100.......110.......120.......130.......140.......150-.-...-....160.......170.......180.......190.......200.......-----210---.........220.......230.......240.......250.......260.......270..---.....280.......290..-.-....300.......310.......320.......330.......340.......350.......360.......370----..-------...-----.-...380.......390....-...400........410.......420......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKRD-KVQTLHGEIHIPGDKSISHRSVMFGALAAGTTTVKNFLPGADCLSTIDCFRKMGVHIE--Q-SSSDVVIHGKGIDALKEPESLLDVGNSGTTIRLMLGILAGRPFYSAVAGDESIAKRPMKRVTEPLKKMGAKIDGRAGGEFTPLSVSG-A-S-LKG-IDYVSPVASAQIKSAVLLAGLQAEGTTTVTEPHKSRDHTERMLSAFGVKLSEDQ-----T-----SVSIAGGQKLTAADIFVPGDISSAAFFLAAGAMVPNSRIVLKNVGLNPTRTGIIDVLQNMGAKL---EIKPSADSGAEPYGDLIIET-S-SLKAVEIGGDIIPRLIDEIPIIALLATQAEGTTVIKDAAELKVKETNRIDTVVSELRKLGAEIEPTADGMKVYGK------QT-------LKG-----G-AAVSSHGDHRIGMMLGIASC-ITEE-PIEIEHTDAIHVSYPTFFEHLNKLSKKS
23 PsiBlast_CBE 95.7368%-112 - C7 -3RMT AROA1_BACHD B:[15-434] ---------LKGTIKVPGDKSISHRAVMFGALAKGTTTVEGFLPGADCLSTISCFQKLGVSIE--Q-AEERVTVKGKGWDGLREPSDILDVGNSGTTTRLILGILSTLPFHSVIIGDESIGKRPMKRVTEPLKSMGAQIDGRDHGNLTPLSIRG-G-Q-LKG-IDFHSPVASAQMKSAILLAGLRAEGKTSVTEPAKTRDHTERMLEAFGVNIEKDG-----L-----TVSIEGGQMLTGQHVVVPGDISSAAFFLVAGAMVPHSRITLTNVGINPTRAGILEVLKQMGATL---AMENERVQGGEPVADLTIET-S-VLQGVEIGGDIIPRLIDEIPIIAVLATQASGRTVIKDAEE-----TNRIDTVVSELTKLGASIHATDDGMIIEGP------TP-------LKG-----G-VTVSSHGDHRIGMAMAIAAL-LAEK-PVTVEGTEAIAVSYPSFFDHLDRLKSEA
1 PsiBlast_PDB 95.0668%-112 - C7 -3RMT AROA1_BACHD A:[15-434] ---------LKGTIKVPGDKSISHRAVMFGALAKGTTTVEGFLPGADCLSTISCFQKLGVSIE--Q-AEERVTVKGKGWDGLREPSDILDVGNSGTTTRLILGILSTLPFHSVIIGDESIGKRPMKRVTEPLKSMGAQIDGRDHGNLTPLSIRG-G-Q-LKG-IDFHSPVASAQMKSAILLAGLRAEGKTSVTEPAKTRDHTERMLEAFGVNIEKDG-----L-----TVSIEGGQMLTGQHVVVPGDISSAAFFLVAGAMVPHSRITLTNVGINPTRAGILEVLKQMGATL---AMENERVQGGEPVADLTIET-S-VLQGVEIGGDIIPRLIDEIPIIAVLATQASGRTVIKD-----VKETNRIDTVVSELTKLGASIHATDDGMIIEGP------TP-------LKG-----G-VTVSSHGDHRIGMAMAIAAL-LAEK-PVTVEGTEAIAVSYPSFFDHLDRLKSEA
21 PsiBlast_CBE 94.6368%-107 - C7 -3RMT AROA1_BACHD D:[15-434] ---------LKGTIKVPGDKSISHRAVMFGALAKGTTTVEGFLPGADCLSTISCFQKLGVSIE--Q-AEERVTVKGKGWDGLREPSDILDVGNSGTTTRLILGILSTLPFHSVIIGDESIGKRPMKRVTEPLKSMGAQIDGRDHGNLTPLSIRG-G-Q-LKG-IDFHSPVASAQMKSAILLAGLRAEGKTSVTEPAKTRDHTERMLEAFGVNIEKDG-----L-----TVSIEGGQMLTGQHVVVPGDISSAAFFLVAGAMVPHSRITLTNVGINPTRAGILEVLKQMGATL---AMENERVQGGEPVADLTIET-S-VLQGVEIGGDIIPRLIDEIPIIAVLATQASGRTVIKDAEE-----TNRIDTVVSELTKLGASIHATDDGMIIEGP------TP-------LKG-----G-VTVSSHGDHRIGMAMAIAAL-LAEK-PVTVEGTEAIAVSYPSFFDHLDRLKSEA
22 PsiBlast_CBE 94.5968%-105 - C7 -3RMT AROA1_BACHD C:[15-434] ---------LKGTIKVPGDKSISHRAVMFGALAKGTTTVEGFLPGADCLSTISCFQKLGVSIE--Q-AEERVTVKGKGWDGLREPSDILDVGNSGTTTRLILGILSTLPFHSVIIGDESIGKRPMKRVTEPLKSMGAQIDGRDHGNLTPLSIRG-G-Q-LKG-IDFHSPVASAQMKSAILLAGLRAEGKTSVTEPAKTRDHTERMLEAFGVNIEKDG-----L-----TVSIEGGQMLTGQHVVVPGDISSAAFFLVAGAMVPHSRITLTNVGINPTRAGILEVLKQMGATL---AMENERVQGGEPVADLTIET-S-VLQGVEIGGDIIPRLIDEIPIIAVLATQASGRTVIKDAEELKVKETNRIDTVVSELTKLGASIHATDDGMIIEGP------TP-------LKG-----G-VTVSSHGDHRIGMAMAIAAL-LAEK-PVTVEGTEAIAVSYPSFFDHLDRLKSEA
42 HHSearch 93.0967% -93 - C7 -3RMT AROA1_BACHD A:[8-433] -VIP-HAKGLKGTIKVPGDKSISHRAVMFGALAKGTTTVEGFLPGADCLSTISCFQKLGVSIE--Q-AEERVTVKGKGWDGLREPSDILDVGNSGTTTRLILGILSTLPFHSVIIGDESIGKRPMKRVTEPLKSMGAQIDGRDHGNLTPLSIRG-G-Q-LKG-IDFHSPVASAQMKSAILLAGLRAEGKTSVTEPAKTRDHTERMLEAFGVNIEKDG-----L-----TVSIEGGQMLTGQHVVVPGDISSAAFFLVAGAMVPHSRITLTNVGINPTRAGILEVLKQMGATL---AMENERVQGGEPVADLTIET-S-VLQGVEIGGDIIPRLIDEIPIIAVLATQASGRTVIKD-----VKETNRIDTVVSELTKLGASIHATDDGMIIEGP------TP-------L-K-----GGVTVSSHGDHRIGMAMAIAAL-LAEK-PVTVEGTEAIAVSYPSFFDHLDRLKSE-
3 PsiBlast_PDB 83.4052% -38 - C7 -1RF5 - AROA_STRPN A:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
25 PsiBlast_CBE 81.4752% -32 - C7 -1RF6 AROA_STRPN C:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
24 PsiBlast_CBE 81.1152% -29 - C7 -1RF6 AROA_STRPN D:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
26 PsiBlast_CBE 80.9252% -31 - C7 -1RF6 AROA_STRPN B:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
4 PsiBlast_PDB 80.7852% -32 - C7 -1RF6 AROA_STRPN A:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
28 PsiBlast_CBE 80.7652% -31 - C7 -1RF4 AROA_STRPN C:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
27 PsiBlast_CBE 80.7252% -30 - C7 -1RF4 AROA_STRPN D:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
2 PsiBlast_PDB 80.1452% -29 - C7 -1RF4 AROA_STRPN A:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
29 PsiBlast_CBE 80.0252% -30 - C7 -1RF4 AROA_STRPN B:[4-424] --KT-NIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAINTSYPSFFDDLESL----
9 PsiBlast_PDB 78.4448% -40 - C7 -4N3P ? A:[5-425] --KT-NIRHLHGIIRVPGDSSISVLSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGASIVAISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASNSVKSALMFAALQAKGESVIIEKEYTSNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGIEETLTGIIDVIRAMGGKLEITEIDPVAKSAT-----LIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------LH------G-ARVNTFGDHRIGMMTAIAAL-LVADGEVELDRAEAI----PSFFDDLESL----
40 HHSearch 74.1553% 19 - C7 -1RF6 AROA_STRPN A:[1-426] MKLKTNIRHLHGIIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGVEIE--D-KDGVITVQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKRPMDRVTLPLKKMGVSISGQTERDLPPLRLKG-TKN-LRP-IHYELPIASAQVKSALMFAALQAKGESVIIEKEYTRNHTEDMLQQFGGHLSVDG-----K-----KITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKL---EITEID--PVAKSATLIVES-S-DLKGTEICGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITPTADGMIIKGK------SA-------L-H-----G-ARVNTFGDHRIGMMTAIAALLVADG-EVELDRAEAINTSYPSFFDDLESLIH--
38 PsiBlast_CBE 73.2546% -3 - C7 -3ROI AROA_COXBU B:[12-428] -------QGLSGEICVPGDKSISHRAVLLAAIAEGQTQVDGFLMGADNLAMVSALQQMGASIQVIE-DENILVVEGVGMTGLQAPPEALDCGNSGTAIRLLSGLLAGQPFNTVLTGDSSLQRRPMKRIIDPLTLMGAKID--STGNVPPLKIYGNP-R-LTG-IHYQLPMASAQVKSCLLLAGLYARGKTCITEPAPSRDHTERLLKHFHYTLQKDK-----Q-----SICVSGGGKLKANDISIPGDISSAAFFIVAATITPGSAIRLCRVGVNPTRLGVINLLKMMGADI---EVTHYTEK-EEPTADITVRH-A-RLKGIDIPPDQVPLTIDEFPVLLIAAAVAQGKTVLRDAAELRVKETDRIAAMVDGLQKLGIAAESLPDGVIIQGG-------T-------LEG-----G--EVNSYDDHRIAMAFAVAGT-LAKG-PVRIRNCDNVKTSFPNFVELANEV----