@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu22630: (2016-07-05 )
MFKLDLQPSEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELGVAYSDPLADGPVIQRASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRENHIDGLLVPDLPLEESNSLQEECKSHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRNEFNSSVYPFIRTVKNLSTVPVAVGFGISNREQVIKMNEISDGVVVGSALVRKIEELKDRLISAETRNQALQEFEDYAMAFSGLYSLK

Atome Classification :

(67 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150-.-...-....160.......170.......180........190.......200.......210.-..-..-.-.-220.......230---.........240.......250.......260.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFKLDLQPSEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELGVAYSDPLADGPVIQRASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRENHIDGLLVPDLPLEESNSLQEECKSHEVTYISLVAP-T-S-ESR-LKTIIEQAEGFVYCVSSLGVTGVRNE-FNSSVYPFIRTVKNLSTVPVAVGFGISNREQV-IK-MN-E-I-SDGVVVGSALV-----RKIEELKDRLISAETRNQALQEFEDYAMAFSGLYSLK
89 HHSearch 88.1240% -85 - C3 -1RD5 TRPA_MAIZE A:[15-261] -------KGKTAFIPYITAGDPDLATTAEALRLLDGCGADVIELGVPCSDPYIDGPIIQASVARALASGTTMDAVLEMLREVTP-ELSCPVVLLSYYKPIMF----RSLAKMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTP-A-IPEDR-MKEITKASEGFVYLVSVNGVTGPR-ANVNPRVESLIQEVKKVTNKPVAVGFGISKPEHV-KQ-IAQW-G-ADGVIIGSAMV-----RQLGEAASP-------KQGLRRLEEYARGMKNAL---
4 PsiBlast_PDB 87.6739% -83 - C3 -1TJR TRPA_MAIZE A:[19-253] ------------FIPYITAGDPDLATTAEALRLLDGCGADVIELGVPCSDPYIDGPIIQASVARALASGTTMDAVLEMLREVTPE-LSCPVVLLSYYKPIMSRS----LAEMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTP-AIP-EDR-MKEITKASEGFVYLVSVNGVTGPRAN-VNPRVESLIQEVKKVTNKPVAVGFGISKPEHV-KQ-IA-Q-WGADGVIIGSAMV-----RQLGE-------AASPKQGLRRLEEYA----------
14 PsiBlast_PDB 87.2639%-108 - C3 -2E09 - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKAFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
2 PsiBlast_PDB 86.5239% -84 - C3 -1RD5 TRPA_MAIZE A:[20-254] ------------FIPYITAGDPDLATTAEALRLLDGCGADVIELGVPCSDPYIDGPIIQASVARALASGTTMDAVLEMLREVTPE-LSCPVVLLSYYKPIMFRS----LAKMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTP-AIP-EDR-MKEITKASEGFVYLVSVNGVTGPRAN-VNPRVESLIQEVKKVTNKPVAVGFGISKPEHV-KQ-IA-Q-WGADGVIIGSAMV-----RQLGE-------AASPKQGLRRLEEYA----------
103 Fugue 86.2037% -98 - C3 -1GEQ - TRPA_PYRFU A:[1-248] MFK------DGSLIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLY-------E-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VS-LL-KEG-ANGVVVGSALV-----KIIGEK---------GREATEFLKKKVEELLGI----
82 HHSearch 85.4843%-127 - C3 -1UJP TRPA_THET2 A:[13-251] -------EGRAALIPYLTAGFPSREGFLQAVEEVL-PYADLLEIGLPYSD----GPVIQRASELALRKGMSVQGALELVREVRA-LTEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAP-T-STDAR-IATVVRHATGFVYAVSV-------------EVKDLVRRIKARTALPVAVGFGVSGKATA-AQ-A--A-V-ADGVVVGSALV-----RALEEG-------------------------------
88 HHSearch 85.2837% -95 - C3 -1GEQ - TRPA_PYRFU A:[3-246] --------KDGSLIPYLTAGDPDKQSTLNFLLALDE-YAGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRR-HSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAP-N-TPDER-LKVIDDMTTGFVYLVSLY--------EIPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VS-LLKE-G-ANGVVVGSALV-----KIIGEKGRE---------ATEFLKKKVEELL------
15 PsiBlast_PDB 84.8139%-110 - C3 -2DZT - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVAGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
5 PsiBlast_PDB 84.7239%-106 - C3 -2DZS - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAAAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
8 PsiBlast_PDB 84.6239%-115 - C3 -1GEQ - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLY-------E-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
10 PsiBlast_PDB 84.4439%-113 - C3 -5E0K - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLY------EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
7 PsiBlast_PDB 84.0739%-106 - C3 -2DZW - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
11 PsiBlast_PDB 83.6339%-106 - C3 -2DZP - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPNKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
12 PsiBlast_PDB 83.5839%-106 - C3 -2DZV - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-AER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
13 PsiBlast_PDB 83.4139%-107 - C3 -2DZU - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVNGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
6 PsiBlast_PDB 83.1839%-111 - C3 -2DZX - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIARAAGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
16 PsiBlast_PDB 82.8733%-164 - C- -3THA - TRPA_CAMJE A:[14-229] -------------VAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKTKK---ALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSV-T-TPKER-VKKLVKHAKGFIYLLASIGITGTKSV-EEAILQDKVKEIRSFTNLPIFVGFGIQNNQDV-KR-MR-K-V-ADGVIVGTSIV-----K------------------------------------
9 PsiBlast_PDB 82.4639%-106 - C3 -1WDW - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLY------EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALV-----KIIGE--------------------------------
1 PsiBlast_PDB 81.4040%-112 - C3 -1WXJ TRPA_THET2 A:[18-257] ------------LIPYLTAGFPSREGFLQAVEEVLPY-ADLLEIGLPYS-----GPVIQRASELALRKGMSVQGALELVREVRAL-TEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAP-T-STDAR-IATVVRHATGFVYAVS--------------EVKDLVRRIKARTALPVAVGFGVSGK-AT-AA-QA-A-V-ADGVVVGSALV-----RALEEGRSLAPLLQEIRQGLQRLE-------------
3 PsiBlast_PDB 81.1939%-112 - C3 -2EKC - TRPA_AQUAE A:[13-249] ------EKREKALVSYLMVGYPDYETSLKAFKEVLKNGTDILEIGFPFSDPVADGPTIQVAHEVALKNGIRFEDVLELSETLRKEFPDIPFLLMTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSFVPLGAP-T-STRKR-IKLICEAADEMTYFVSVTG---------YERIKKKVEEYRELCDKPVVVGFGVSKKEHA-RE-IG-S-F-ADGVVVGSALVKLAGQKKIEDL-------------------------------
27 PsiBlast_CBE 79.0635%-105 - C3 -4KKX TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
61 PsiBlast_CBE 78.9835%-102 - C3 -1WBJ TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
60 PsiBlast_CBE 78.9835%-102 - C3 -2CLK TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
31 PsiBlast_CBE 78.8635%-103 - C3 -4HN4 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
62 PsiBlast_CBE 78.8435%-102 - C3 -1QOP TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
55 PsiBlast_CBE 78.3335%-101 - C3 -1C8V TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
56 PsiBlast_CBE 78.2235%-101 - C3 -1C29 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
30 PsiBlast_CBE 78.1735%-105 - C3 -4HPJ TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
28 PsiBlast_CBE 78.1035%-106 - C3 -4HT3 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
25 PsiBlast_CBE 78.0435%-105 - C3 -4XUG TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
53 PsiBlast_CBE 78.0135%-103 - C3 -1CW2 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
29 PsiBlast_CBE 77.9335%-103 - C3 -4HPX TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
44 PsiBlast_CBE 77.8935%-103 - C3 -1TJP TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
32 PsiBlast_CBE 77.8735%-112 - C3 -2TSY TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN-------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
50 PsiBlast_CBE 77.8535%-102 - C3 -1K3U TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
58 PsiBlast_CBE 77.8035%-107 - C3 -1A50 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN-------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
59 PsiBlast_CBE 77.7635%-103 - C3 -3CEP TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
57 PsiBlast_CBE 77.7535%-107 - C3 -1A5S TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN---------LIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
49 PsiBlast_CBE 77.7335%-113 - C3 -1K7E TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG--------PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
36 PsiBlast_CBE 77.6635%-103 - C3 -2J9X TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G---LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
51 PsiBlast_CBE 77.6235%-106 - C3 -1FUY TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
54 PsiBlast_CBE 77.4435%-100 - C3 -1C9D TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
40 PsiBlast_CBE 77.4435%-108 - C3 -2CLI TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG-----------HLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
23 PsiBlast_CBE 77.0335%-106 - C3 -4ZQC ? A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
17 PsiBlast_PDB 76.8535%-102 - C3 -3PR2 TRPA_SALTY A:[15-242] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
73 PsiBlast_CBE 76.2435%-113 * C3 *1KFB TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSR--------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
52 PsiBlast_CBE 76.0635%-100 - C3 -1CX9 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
45 PsiBlast_CBE 76.0535%-119 - C3 -1QOQ TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
42 PsiBlast_CBE 75.9935%-120 - C3 -2CLF TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
46 PsiBlast_CBE 75.8435%-116 - C3 -1K8Z TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS------------ALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
39 PsiBlast_CBE 75.7735%-111 - C3 -2CLL TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG----------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
34 PsiBlast_CBE 75.5735%-120 - C3 -2RHG TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS------------------LIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
41 PsiBlast_CBE 75.5635%-111 - C3 -2CLH TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG----------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
35 PsiBlast_CBE 75.4535%-120 - C3 -2RH9 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
37 PsiBlast_CBE 75.4435%-109 - C3 -2CLO TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG----------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
26 PsiBlast_CBE 75.3435%-120 - C3 -4WX2 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
38 PsiBlast_CBE 75.3235%-118 - C3 -2CLM TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
47 PsiBlast_CBE 75.1835%-118 - C3 -1K8Y TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS--------------PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
33 PsiBlast_CBE 75.1835%-106 - C3 -2TRS TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN-------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
43 PsiBlast_CBE 75.0935%-116 - C3 -2CLE TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
74 PsiBlast_CBE 75.0635%-116 - C3 -1KFC TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
71 PsiBlast_CBE 75.0035%-112 - C3 -1BEU TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTY----------------LPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
24 PsiBlast_CBE 75.0035%-117 - C3 -4Y6G ? A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSG------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
48 PsiBlast_CBE 74.8235%-117 - C3 -1K7F TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIV-----KIIEK--------------------------------
75 PsiBlast_CBE 74.3835%-119