@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu22670: (2016-07-05 )
MNRFLQLCVDGKTLTAGEAETLMNMMMAAEMTPSEMGGILSILAHRGETPEELAGFVKAMRAHALTVDGLPDIVDTCGTGGDGISTFNISTASAIVASAAGAKIAKHGNRSVSSKSGSADVLEELEVSIQTTPEKVKSSIETNNMGFLFAPLYHSSMKHVAGTRKELGFRTVFNLLGPLSNPLQAKRQVIGVYSVEKAGLMASALETFQPKHVMFVSSRDGLDELSITAPTDVIELKDGERREYTVSPEDFGFTNGRLEDLQVQSPKESAYLIQNIFENKSSSSALSITAFNAGAAIYTAGITASLKEGTELALETITSGGAAAQLERLKQKEEEIYA

Atome Classification :

(66 SA) .........10........20........30........40........50........60-....--.....70--..-.......80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280--........290.......300-------..------.....310.......320.......330......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNRFLQLCVDGKTLTAGEAETLMNMMMAAEMTPSEMGGILSILAHRGETPEELAGFVKAM--RAHA--LTVDGL---PD-IVDTCGTGGDGISTFNISTASAIVASAAGAKIAKHGNRSVSSKSGSADVLEELEVSIQTTPEKVKSSIETNNMGFLFAPLYHSSMKHVAGTRKELGFRTVFNLLGPLSNPLQAKRQVIGVYSVEKAGLMASALETFQPKHVMFVSSRDGLDELSITAPTDVIELKDGERREYTVSPEDFGFTNGRLEDLQVQSPKESAYLIQNIFENKS---SSSALSITAFNAGAAIYTAGI-------TA------SLKEGTELALETITSGGAAAQLERLKQKEEEIYA
90 HHSearch 93.1436%-104 - C7 -1O17 - TRPD_SULSO A:[3-334] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKIDV----PN-AIDTAG----GLGTVNVSTASAILLS-LVNPVAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGK----DEHVAEFIKINTAVALFALDR-------VG------DFREGYEYADHLIE--KSLDKLNEIISMNGDVT-
30 PsiBlast_CBE 89.4838% -98 - C7 -1ZXY TRPD_SULSO B:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
6 PsiBlast_PDB 89.2838%-110 - C7 -1O17 - TRPD_SULSO A:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAG----GLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
22 PsiBlast_CBE 89.2738%-103 - C7 -2GVQ TRPD_SULSO D:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
27 PsiBlast_CBE 89.1738% -98 - C7 -1ZYK TRPD_SULSO B:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
37 PsiBlast_CBE 89.1437%-103 - C7 -3GBR TRPD_SULSO B:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGGGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLSAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
26 PsiBlast_CBE 89.1238% -98 - C7 -1ZYK TRPD_SULSO C:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
23 PsiBlast_CBE 89.0938%-107 - C7 -2GVQ TRPD_SULSO C:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAG----GLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
8 PsiBlast_PDB 88.9638% -97 - C7 -1ZXY TRPD_SULSO A:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
10 PsiBlast_PDB 88.6038%-104 - C7 -2GVQ TRPD_SULSO A:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTG---LGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
25 PsiBlast_CBE 88.4338% -95 - C7 -1ZYK TRPD_SULSO D:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
29 PsiBlast_CBE 88.4238% -97 - C7 -1ZXY TRPD_SULSO C:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
28 PsiBlast_CBE 88.2038% -98 - C7 -1ZXY TRPD_SULSO D:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
33 PsiBlast_CBE 88.1638%-104 - C7 -1GXB TRPD_SULSO B:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAG---DGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
24 PsiBlast_CBE 87.7038%-106 - C7 -2GVQ TRPD_SULSO B:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTG---LGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
7 PsiBlast_PDB 87.5238%-106 - C7 -1GXB TRPD_SULSO A:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAG----GLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
9 PsiBlast_PDB 87.3438%-100 - C7 -1ZYK TRPD_SULSO A:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
31 PsiBlast_CBE 86.8338% -98 - C7 -1GXB TRPD_SULSO D:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAGTGGDGLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
32 PsiBlast_CBE 86.5938%-105 - C7 -1GXB TRPD_SULSO C:[3-312] INEILKKLINKSDLEINEAEELAKAIIRGEVPEILVSAILVALRMKGESKNEIVGFARAM--RELA--IKID-V---PN-AIDTAG----GLGTVNVSTASAILLSLVNP-VAKHGNRAVSGKSGSADVLEALGYNIIVPPERAKELVNKTNFVFLFAQYYHPAMKNVANVRKTLGIRTIFNILGPLTNPANAKYQLMGVFSKDHLDLLSKSAYELDFNKIILVYGEPGIDEVSPIGNTFMKIVSKRGIEEVKLNVTDFGISPIPIEKLIVNSAEDSAIKIVRAFLGKD---EHVA-EFIKINTAVALFALDR-------VG------DFREGYEYA-------------------------
85 HHSearch 84.4240% -19 - C7 -4HKM TRPD_XANCP A:[6-343] PQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVM--REFS--RRVEVTDR-RH-MVDIVGT------TFNISTCAMFVAAAGGAKVAKHG---------SADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDGQVHEYEVHPEDFGIAMSA---------AESRAMLLQVLDNV----PGPALDIVALNAGAALYVAGV-------AD------SIADGIVRARQVLADGSARACLDAYVAFTQQAT-
89 HHSearch 83.8442% -24 - C7 -2ELC TRPD_THET8 A:[2-328] --DAVKKAILGEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAM--REAA--RPLRVHR--RP-LLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYVLGVFSPEWLAPMAEALERLGA-RGLVVHG-EGADELVL-GENRVVEVGKG---AYALTPEEVGLKRAPLEALKGGGPEENAALARRLLKGEE---KGPLADAVALAAGAGFYAAGK-------TP------SLKEGVALAREVLASGEAYLLLERYVAFLR----
84 HHSearch 81.4939% -1 - C7 -4YI7 TRPD_ACIAD A:[19-360] IQQALNHITKNIHLTQAQMEDVMRSIMQGEATEAQIGALMMGLRMKGESIDEITAAARVM--RELA--IKIDVSDI-QY-LVDIVGTGGD--NLFNVSTASSFVIAAAGATIAKHGNR-------SSDLLEQAGINLDLDMQQTERCIREMGVGFLFA------MKYAVGPRRELGIRSIFNLLGPLTNPAGVKRFVIGVFSDELCRPIAEVMKQLGAEHVMVVHSKDGLDEISLASQTYIAELKNGEVTEWVLNPEDVNIPSQTLSGLIVEDSNASLKLIKDALGRKKSDIGEKAANMIALNAGAGIYVSGL-------AT------SYKQGVALAHDIIYGGQALEKMSILSEFTKALK-
39 PsiBlast_CBE 81.3633% -30 - C7 -4N93 TRPD_MYCTU B:[29-370] --QILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LPADTV---PDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARR-SSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGAR---GPVRDAVVLNAAGAIVAHAGL-------SSAEWLP-AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI--
42 PsiBlast_CBE 80.9333% -30 - C7 -3UU1 TRPD_MYCTU C:[28-369] --QILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LPADTV---PDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAAS---GGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARR-SSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGAR---GPVRDAVVLNAAGAIVAHAGL---------EWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI--
14 PsiBlast_PDB 80.7333% -29 - C7 -4N5V TRPD_MYCTU A:[29-370] --QILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LPADTV---PDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARR-SSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGAR---GPVRDAVVLNAAGAIVAHAGL-------SSAEWLP-AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI--
66 PsiBlast_CBE 80.7133% -27 - C7 -4OWM TRPD_MYCTU B:[29-370] --QILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHP--LPADTV---PDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAA--LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARR-SSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGAR---GPVRDAVVLNAAGAIVAHAGL-------SSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI--