@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu22700: (2016-07-05 )
MKTLHVQTASSSYPVFIGQGIRKKACELLTSLNRPLTRIMFVTDEEVDRLYGDEMLHLLQEKWPVKKVTVPSGEQAKSMDMYTKLQSEAIRFHMDRSSCIIAFGGGVVGDLAGFVAATFMRGIDFIQMPTTLLAHDSAVGGKVAVNHPLGKNLIGAFYQPKAVLYDTDFLRSLPEKELRSGMAEVIKHAFIYDRAFLEELLNIHSLRDITNDQLNDMIFKGISIKASVVQQDEKEEGIRAYLNFGHTLGHAVEAEYGYGQITHGDAVALGMQFALYISEKTVGCEMDRKRLVSWLKSLGYPSQIRKETETSVLLNRMMNDKKTRGGKIQFIVLNELGKVADHTFSRNELESWLNKWRLEETS

Atome Classification :

(39 SA) .........10........20..--..-....30......---..40........50........60-.-------.----.--------..--...-70--.........80........90..--....-..100........110.......120.......130...-....140.......150.......160.......170.......180.......190..---..---..-.200.-....-----...-210------------...---------....---..220.......230.......240.......250.....-.-.260.......270---....-------...-.280-...-.-...-.290---.........300..-.----------.-..---------.310----------.......320.-----......330...-....340.--.------.....350.......360----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKTLHVQTASSSYPVFIGQGIRK--KA-CELLTSLNRPLT---RIMFVTDEEVDRLYGDEMLHLLQE-K-------W----P--------VK--KVT-V---PSGEQAKSMDMYTKLQSEAIRFH--MDRS-SCI-IAFGGGVVGDLAGFVAATFMRGIDFIQMPTTLLAH-DSAVGGKVAVNHPLGKNLIGAFYQPKAVLYDTDFLRSLPEKELRSGMAEVIKHAFIYDR---AF---LE-EL-LN-IHSL-----RDI-T--------------NDQ---------LNDM---IFKGISIKASVVQQDEKEEGIRAYLNFGHTLGHAVEAEYG-Y-GQITHGDAVALGM----QFAL-------YIS-EKT--VGC-E-MDR-KR-----LVSWLKSLGYPSQI-R----------K-ET---------ETSV----------LLNRMMNDKKT-----RGGKIQFIVLNE-LGKVADHT--F------SRNELESWLNKWRLEETS----
1 PsiBlast_PDB 87.2940% -68 - C3 -3OKF AROB_VIBCH A:[30-370] MERITVNLGERSYPISIGAGLFA--NP-ALLSLSAKQ------KVVIVTNHTVAPLYAPAIISLLDH-I-------G----C--------QH--ALLEL---PDGEQYKTLETFNTVMSFLLEHN--YSRD-VVV-IALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDS---AF---FD-WLEAQ-MEAL-----YAL-D--------------EQA---------LTYA---IARCCQIKAEVVAQDEK--GIRALLNLGHTFGHAIEAHMG-Y-GNWLHGEAVSAGT----VMAA-------KTA-QLQ--GLI-D-ASQFER-----ILAILKKAHLPVRT-P----------E-NM---------TFAD----------FMQHMMRDKKV-----LAGELRLVLPTS-IGTSA----------------------------------
41 HHSearch 86.3740% -44 - C3 -3OKF AROB_VIBCH A:[33-388] ---ITVNLGERSYPISIGAGLFA--NP-ALLS---LSAKQ---KVVIVTNHTVAPLYAPAIISLLDH-I------------G--------CQHALLE-L---PDGEQYKTLETFNTVMSFLLEHN--YSRD-VVV-IALGGGVIGDLVGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVVIDTDCLTTLPAREFAAGMAEVIKYGIIYDS---AF---FD-WL-EAQMEAL-----YAL-D--------------EQA---------LTYA---IARCCQIKAEVVAQDEK--GIRALLNLGHTFGHAIEAHMG-YGN-WLHGEAVSAGT----VMAA-------KTA-QLQ--GLI-DASQF-ER-----ILAILKKAHLPVRT-P----------E-NM---------TFAD----------FMQHMMRDKKV-----LAGELRLVLPTS-IGTSAVVK--GV-----PEAVIAQAIEYCR---------
22 PsiBlast_CBE 85.9938%-101 - C3 -1XAH AROB_STAAR B:[3-333] ---LQTTYPSNNYPIYVEHGAIK--YI-GTYLNQFDQSFL---LI----DEYVNQYFANKFD-------------------N--------VH--KVI-I---PAGEKTKTFEQYQETLEYILSHH--VTRN-TAI-IAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAH-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGE---SA---TQ-DI-EQ-HFKD-----REI-L--------------QS----------LNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEY----Y-HKIPHGHAVMVGI----IYQF-------IVA-NAL--FDS-K-HDI-SH-----YIQYLIQLGYPLD-----------------------------T----------LYQYML-------------GVQMVLMRQ-FGDIV----------------------------------
21 PsiBlast_CBE 85.6038% -87 - C3 -1XAI AROB_STAAR B:[3-333] ---LQTTYPSNNYPIYVEHGAIK--YI-GTYLNQFDQSFL---LI----DEYVNQYFANKFDDILSY-E------------N--------VH--KVI-I---PAGEKTKTFEQYQETLEYILSHH--VTRN-TAI-IAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAH-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGE---SA---TQ-DI-EQ-HFKD-----REI-L--------------QS----------LNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEY----Y-HKIPHGHAVMVGI----IYQF-------IVA-NAL--FDS-K-HDI-SH-----YIQYLIQLGYPLDM-I----------T-DL---------DFET----------LYQYMLSDKKN-----DKQGVQMVLMRQ-FGDIV----------------------------------
3 PsiBlast_PDB 85.4238% -87 - C3 -1XAI AROB_STAAR A:[3-333] ---LQTTYPSNNYPIYVEHGAIK--YI-GTYLNQFDQSFL---LI----DEYVNQYFANKFDDILSY-E------------N--------VH--KVI-I---PAGEKTKTFEQYQETLEYILSHH--VTRN-TAI-IAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAH-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGE---SA---TQ-DI-EQ-HFKD-----REI-L--------------QS----------LNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEY----Y-HKIPHGHAVMVGI----IYQF-------IVA-NAL--FDS-K-HDI-SH-----YIQYLIQLGYPLDM-I----------T-DL---------DFET----------LYQYMLSDKKN-----DKQGVQMVLMRQ-FGDIV----------------------------------
2 PsiBlast_PDB 85.2838% -85 - C3 -1XAG AROB_STAAR A:[3-333] ---LQTTYPSNNYPIYVEHGAIK--YI-GTYLNQFDQSFL---LI----DEYVNQYFANKFDDILSY-E------------N--------VH--KVI-I---PAGEKTKTFEQYQETLEYILSHH--VTRN-TAI-IAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAH-DSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGE---SA---TQ-DI-EQ-HFKD-----REI-L--------------QS----------LNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEY----Y-HKIPHGHAVMVGI----IYQF-------IVA-NAL--FDS-K-HDI-SH-----YIQYLIQLGYPLDM-I----------T-DL---------DFET----------LYQYMLSDKKN-----DKQGVQMVLMRQ-FGDIV----------------------------------
45 HHSearch 81.3339% -28 * C3 *3ZOK DHQS_ACTCH A:[16-377] --IVDVDLGDRSYPIYIGSGLLD--QP-DLLQR--HVHGK---RVLVVTNSTVAPIYLDKVVGALTN-EN------P----N--------VSVESVI-L---PDGEKYKNMDTLMKVFDKAIESR--LDRR-CTF-VALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDA---NF---FE-WQ-EKNMPAL-----MAR-D--------------PSA---------LAYA---IKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFG-YGQ-WLHGEAVAAGM----VMAV-------DMS-YRL--GWI-DESIV-NR-----AHNILQQAKLPTAP-P----------E-TM---------TVEM----------FKSVMAVDKKV-----ADGLLRLILLKGPLGNCVFTG--DY-----DRKALDETLHAFCK--------
25 PsiBlast_CBE 81.1539% -44 - C3 -3ZOK DHQS_ACTCH B:[17-360] ---VDVDLGDRSYPIYIGSGLLD--QP-DLLQRHVHG--K---RVLVVTNSTVAPIYLDKVVGALTN-E-------N----PNVS-----VE--SVI-L---PDGEKYKNMDTLMKVFDKAIESR--LDRR-CTF-VALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDA---NF---FEWQE-KN-MPAL-----MAR-D--------------PSA---------LAYA---IKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFG-Y-GQWLHGEAVAAGM----VMAVDMSYRLGWID-ESI--V---------NR-----AHNILQQAKLPTAP-P----------E-TM---------TVEM----------FKSVMAVDKKV-----ADGLLRLILLK---GPLGNCV--F------T---------------------
4 PsiBlast_PDB 81.0639% -43 - C3 -3ZOK DHQS_ACTCH A:[17-360] ---VDVDLGDRSYPIYIGSGLLD--QP-DLLQRHVHG--K---RVLVVTNSTVAPIYLDKVVGALTN-E-------N----PNVS-----VE--SVI-L---PDGEKYKNMDTLMKVFDKAIESR--LDRR-CTF-VALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDA---NF---FEWQE-KN-MPAL-----MAR-D--------------PSA---------LAYA---IKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFG-Y-GQWLHGEAVAAGM----VMAVDMSYRLGWID-ESI--V---------NR-----AHNILQQAKLPTAP-P----------E-TM---------TVEM----------FKSVMAVDKKV-----ADGLLRLILLK---GPLGNCV--F------T---------------------
44 HHSearch 80.8336% -39 - C3 -5EKS ? A:[9-366] MQTLHVELGERRYPIFIGSQLDP--K--QLLEP--YIHGQ---QVMIVSNVTVAPLYLSHYQEALES-L------------GKT------VA--TCI-L---PDGEKYKDIQHLNLIFDALLEAG--FNRD-CTV-LALGGGVIGDMAGFASACFQRGVYFVQVPTTLLSQVDSSVGGKTGINHPLGKNMLGAFQQPQVVLADMAQLNTLPERELSAGLAEVIKYALLGDE---DF---LV-WL-EENMDGL-----VAR-D--------------ADL---------LAEA---VYRSCAHKARIVANDEKE---RALLNLGHTFGHAIESYLG-YGT-WLHGEAVATGM----VMAA-------DLS-QRL--GWI-SNEDV-AR-----TKKIIQRANLPISC-P----------Q--I---------PLDD----------FLGYMAHDKKV--------QLRLVLLKQ-LGQAVITK--DF-----DVELMKQAILANQ---------
23 PsiBlast_CBE 80.6939% -42 - C3 -3ZOK DHQS_ACTCH D:[17-360] ---VDVDLGDRSYPIYIGSGLLD--QP-DLLQRHVHG--K---RVLVVTNSTVAPIYLDKVVGALTN-E-------N----PNVS-----VE--SVI-L---PDGEKYKNMDTLMKVFDKAIESR--LDRR-CTF-VALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDA---NF---FEWQE-KN-MPAL-----MAR-D--------------PSA---------LAYA---IKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFG-Y-GQWLHGEAVAAGM----VMAVDMSYRLGWID-ESI--V---------NR-----AHNILQQAKLPTAP-P----------E-TM---------TVEM----------FKSVMAVDKKV-----ADGLLRLILLK---GPLGNCV--F------T---------------------
50 HHSearch 80.6339% -28 - C3 -5HVN ? A:[13-360] -------TFSPSYNIIVDSVL----DFSHILE---YVTNK---QVLVVTNTTVAKLYLTKFLAALVD-D-------L----D--------VR--TCI-L---EDGEQYKSQQSLDKILSTLLENH--FTRNSTVL-VALGGGVIGDITGFAAAIYQRGIDFIQIPTTLLSQVDSSVGGKTAINHQLGKNMIGAFYQPKVVYTSIEFYKTLPQREYIAGMAEVVKYAFIS-K---DF---YL-WL-DSNRDKI-----LAKDS--------------VTL---------I-EM---VKRSCQIKAQVVAMD---TGARAILNFGHTFGHAIEKCQNYR-G-LKHGEAVGVGM----AQAI-------DFS-HYL--GLI-SQQQA-KD-----FNDFIVSFGISIDF-P----------N-DI---------CQKE----------FLEAMLLD---------NKELKFILIEN-IGSLSLQK--Q------SKNELEQFLDI-----------
24 PsiBlast_CBE 80.0439% -41 - C3 -3ZOK DHQS_ACTCH C:[17-360] ---VDVDLGDRSYPIYIGSGLLD--QP-DLLQRHVHG--K---RVLVVTNSTVAPIYLDKVVGALTN-E-------N----PNVS-----VE--SVI-L---PDGEKYKNMDTLMKVFDKAIESR--LDRR-CTF-VALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDA---NF---FEWQE-KN-MPAL-----MAR-D--------------PSA---------LAYA---IKRSCENKAEVVSLDEKESGLRATLNLGHTFGHAIETGFG-Y-GQWLHGEAVAAGM----VMAVDMSYRLGWID-ESI--V---------NR-----AHNILQQAKLPTAP-P----------E-TM---------TVEM----------FKSVMAVDKKV-----ADGLLRLILLK---GPLGNCV--F------T---------------------
5 PsiBlast_PDB 79.4140% -49 - C3 -5HVN ? A:[39-362] -------------------------------------------QVLVVTNTTVAKLYLTKFLAALVD-D-------L----D--------VR--TCI-L---EDGEQYKSQQSLDKILSTLLENH--FTRN-STVLVALGGGVIGDITGFAAAIYQRGIDFIQIPTTLLSQVDSSVGGKTAINHQLGKNMIGAFYQPKVVYTSIEFYKTLPQREYIAGMAEVVKYAFISKD---FY---LW-LD-SN-RDKI-----LAK-D--------------SVT---------LIEM---VKRSCQIKAQVVAMD---TGARAILNFGHTFGHAIEKCQN-Y-RGLKHGEAVGVGM----AQAI-------DFS-HYL--GLI-S-QQQ-AKDFNDFIVSFGISIDFPNDICQ----------K-E------------------------FLEAMLLD---------NKELKFILIEN-IGSLSLQK--Q------SKNELEQFLDISR---------
64 Fugue 77.0530% -68 - C3 -1UJN - ? A:[1-347] MQRLEVRE-PVPYPILVGEGVLK--E--------VPPLAG---PAALLFD----RRVEGFAQEVAKA-L-------G----V--------RH--LLG-L---PGGEAAKSLEVYGKVLSWLAEKG--LPRN-ATL-LVVGGGTLTDLGGFVAATYLRGVAYLAFPTTTLAIVDASVGGKTGINLPEGKNLVGAFHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGD---EA---LL-KV-ED-LTP----------Q--------------SPR---------LEAF---LARAVAVKVRVTEEDPLEKGKRRLLNLGHTLGHALEAQTR-H-A-LPHGMAVAYGL----LYAA-------LLG-RAL---GG-E-DLL-PP-----VRRLLLWLSPPP------------------------------------------LPPLAFEDLL-----PYLSLHWVVPLA-PGRLVVRP--L------PEGLLREAFAAWREELKGLGLL
26 PsiBlast_CBE 76.8738% -28 - C3 -5EKS ? B:[9-346] MQTLHVEL--RRYPIFIGSQLDP--K-------QLLEPYIHGQQVMIVSNVTVAPLYLSHYQEALESLG-------K----T--------VA--TCI-L---PDGEKYKDIQHLNLIFDALLEAG--FNRD-CTV-LALGGGVIGDMAGFASACFQRGVYFVQVPTTLLSQVDSSVGGKTGINHPLGKNMLGAFQQPQVVLADMAQLNTLPERELSAGLAEVIKYALLGDE---DFLVWLE-E---N-MDGL-----VAR-D--------------ADL---------LAEA---VYRSCAHKARIVANDE----ERALLNLGHTFGHAIESYLG-Y-GTWLHGEAVATGM----VMAA-------DLS-QRLGWISN-E--DV-AR-----TKKIIQRANLPISC------------P-QI---------PLDD----------FLGYMAHDKKV-------GQLRLVLLKQ-LGQ------------------------------------