@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu22730: (2016-07-05 )
MMEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFGELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDSLESAEREINIFFKNEELVSYQQLMAGWIY

Atome Classification :

(81 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MMEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFGELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDSLESAEREINIFFKNEELVSYQQLMAGWIY
2 PsiBlast_PDB 93.7471%-125 - C7 -3VVU - ? A:[1-139] -MERTFVMIKPDGVQRGLIGEIISRFERKGFKIVAMKLMRISQELAEKHYAEHREKPFFSGLVDFITSGPVVAMVLEGKNVVEVVRKMIGATNPKEAAPGTIRGDFGMSVGKNVIHGSDSLESAEREISLFFKDEELVEW---------
3 PsiBlast_PDB 92.3868%-120 - C7 -3VVT - ? A:[1-139] -MERTFVMIKPDGVQRGLIGEIISRFERKGLKIVAMKMMRISREMAEKHYAEHREKPFFSALVDYITSGPVVAMVLEGKNAVEVVRKMVGATNPKEAAPGTIRGDFGLDVGKNVIHASDSPESAEREISLFFKDEELVEW---------
32 PsiBlast_CBE 91.3262%-113 - C7 -3Q8U NDK_STAAC D:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
22 PsiBlast_CBE 90.9262%-110 - C7 -3Q8Y NDK_STAAC G:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
102 HHSearch 90.4672%-106 - C7 -2VU5 - NDK_BACAN A:[1-148] -MEKTFLMVKPDGVQRAFIGEIVARFEKKGFQLVGAKLMQVTPEIAGQHYAEHEEKPFFGELVDFITSGPVFAMVWQGEGVVDTARNMMGKTRPHEAAPGTIRGDFGVTVAKNIIHGSDSLESAEREIGIFFKEEELVDYSKLMNEWIY
1 PsiBlast_PDB 90.4672%-106 - C7 -2VU5 - NDK_BACAN A:[1-148] -MEKTFLMVKPDGVQRAFIGEIVARFEKKGFQLVGAKLMQVTPEIAGQHYAEHEEKPFFGELVDFITSGPVFAMVWQGEGVVDTARNMMGKTRPHEAAPGTIRGDFGVTVAKNIIHGSDSLESAEREIGIFFKEEELVDYSKLMNEWIY
28 PsiBlast_CBE 90.0262%-110 - C7 -3Q8V NDK_STAAC D:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
23 PsiBlast_CBE 89.8162%-111 - C7 -3Q8Y NDK_STAAC F:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
6 PsiBlast_PDB 89.3362%-107 - C7 -3Q89 - NDK_STAAC A:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
36 PsiBlast_CBE 89.2062%-109 - C7 -3Q89 NDK_STAAC B:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
33 PsiBlast_CBE 89.1862%-104 - C7 -3Q8U NDK_STAAC C:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
113 HHSearch 89.1563%-103 - C7 -3Q8U NDK_STAAC A:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
7 PsiBlast_PDB 88.8462%-103 - C7 -3Q8U NDK_STAAC A:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
8 PsiBlast_PDB 88.7662%-107 - C7 -3Q8V NDK_STAAC A:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
30 PsiBlast_CBE 88.6762%-107 - C7 -3Q8U NDK_STAAC F:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
4 PsiBlast_PDB 88.6762%-106 - C7 -3Q83 - NDK_STAAC A:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
27 PsiBlast_CBE 88.6462%-109 - C7 -3Q8Y NDK_STAAC B:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
29 PsiBlast_CBE 88.4862%-107 - C7 -3Q8V NDK_STAAC B:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
31 PsiBlast_CBE 88.4462%-107 - C7 -3Q8U NDK_STAAC E:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
25 PsiBlast_CBE 88.4362%-104 - C7 -3Q8Y NDK_STAAC D:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
9 PsiBlast_PDB 88.3562%-109 - C7 -3Q8Y NDK_STAAC A:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
21 PsiBlast_CBE 88.3162%-107 - C7 -3Q8Y NDK_STAAC H:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
35 PsiBlast_CBE 88.1562%-106 - C7 -3Q89 NDK_STAAC E:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
34 PsiBlast_CBE 87.9562% -97 - C7 -3Q8U NDK_STAAC B:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
37 PsiBlast_CBE 87.8362%-109 - C7 -3Q86 NDK_STAAC B:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
24 PsiBlast_CBE 87.7662%-109 - C7 -3Q8Y NDK_STAAC E:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
84 PsiBlast_CBE 87.2153%-108 - C7 -2HVE NDKA_HUMAN A:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGGDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
79 PsiBlast_CBE 87.1052%-108 - C7 -1NUE NDKB_HUMAN C:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
17 PsiBlast_PDB 87.0559%-130 - C7 -1WKL NDK_THET8 A:[1-137] -MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL-----------
51 PsiBlast_CBE 86.6759%-134 - C7 -1WKL NDK_THET8 B:[1-137] -MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL-----------
77 PsiBlast_CBE 86.6152%-109 - C7 -1NUE NDKB_HUMAN E:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
76 PsiBlast_CBE 86.2052%-109 - C7 -1NUE NDKB_HUMAN F:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
52 PsiBlast_CBE 86.2055%-116 - C7 -1BHN NDKA1_BOVIN F:[5-151] --ERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFHPEELVNYKSCAQNWIY
78 PsiBlast_CBE 86.1452%-109 - C7 -1NUE NDKB_HUMAN D:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
61 PsiBlast_CBE 86.1254%-104 - C7 -2HVD NDKA_HUMAN C:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
80 PsiBlast_CBE 85.8352%-111 - C7 -1NUE NDKB_HUMAN B:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
81 PsiBlast_CBE 85.7852%-112 - C7 -1NUE NDKB_HUMAN A:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
19 PsiBlast_PDB 85.7254%-105 - C7 -1BE4 NDKA2_BOVIN A:[4-150] --ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFRPEELVNYKSCAQNWIY
82 PsiBlast_CBE 85.7153%-112 - C7 -2HVE NDKA_HUMAN C:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGGDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
56 PsiBlast_CBE 85.7155%-101 - C7 -1BHN NDKA1_BOVIN B:[5-151] --ERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFHPEELVNYKSCAQNWIY
18 PsiBlast_PDB 85.4855%-110 - C7 -1BHN NDKA1_BOVIN A:[5-151] --ERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFHPEELVNYKSCAQNWIY
89 PsiBlast_CBE 85.4453%-108 - C7 -4UOG ? A:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
96 PsiBlast_CBE 85.3452%-102 - C7 -1UCN NDKA_HUMAN B:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPWFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIGGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
69 PsiBlast_CBE 85.2452%-106 - C7 -3BBF NDKB_HUMAN C:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
68 PsiBlast_CBE 85.1152%-107 - C7 -3BBF NDKB_HUMAN D:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
62 PsiBlast_CBE 85.0954% -98 - C7 -2HVD NDKA_HUMAN B:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
70 PsiBlast_CBE 84.8152%-107 - C7 -3BBF NDKB_HUMAN B:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
67 PsiBlast_CBE 84.8152%-103 - C7 -3BBF NDKB_HUMAN E:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
83 PsiBlast_CBE 84.7953% -96 - C7 -2HVE NDKA_HUMAN B:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGGDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
5 PsiBlast_PDB 84.7062%-104 - C7 -3Q86 NDK_STAAC A:[1-148] -MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLY
63 PsiBlast_CBE 84.6354%-104 - C7 -2HVD NDKA_HUMAN A:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
16 PsiBlast_PDB 84.6359%-122 - C7 -1WKK NDK_THET8 A:[1-137] -MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL-----------
50 PsiBlast_CBE 84.4653%-117 - C7 -1ZS6 NDK3_HUMAN B:[22-168] --ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLY
74 PsiBlast_CBE 84.3352%-105 - C7 -3BBB NDKB_HUMAN C:[4-150] --ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
90 PsiBlast_CBE 84.2853%-106 - C7 -4UOF ? C:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
97 PsiBlast_CBE 84.2652%-106 - C7 -1UCN NDKA_HUMAN A:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPWFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIGGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
87 PsiBlast_CBE 84.2353%-108 - C7 -4UOG ? C:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
95 PsiBlast_CBE 83.9352%-100 - C7 -1UCN NDKA_HUMAN C:[4-151] -CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPWFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIGGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIY
49 PsiBlast_CBE 83.7053%-110 - C7 -1ZS6 NDK3_HUMAN D:[22-168] --ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLY
71 PsiBlast_CBE 83.6552%-104 - C7 -3BBF NDKB_HUMAN A:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
66 PsiBlast_CBE 83.6552%-103 - C7 -3BBF NDKB_HUMAN F:[3-150] -LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
53 PsiBlast_CBE 83.6455%-100 - C7 -1BHN NDKA1_BOVIN E:[5-151] --ERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFHPEELVNYKSCAQNWIY
98 PsiBlast_CBE 83.5859%-111 - C7 -2BEF NDKC_DICDI C:[9-145] --ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLT----------
100 PsiBlast_CBE 83.4959%-105 - C7 -2BEF NDKC_DICDI A:[9-145] --ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLT----------
57 PsiBlast_CBE 83.4654%-104 - C7 -1BE4 NDKA2_BOVIN C:[4-150] --ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFRPEELVNYKSCAQNWIY
55 PsiBlast_CBE 83.4555% -96 - C7 -1BHN NDKA1_BOVIN C:[5-151] --ERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFHPEELVNYKSCAQNWIY
54 PsiBlast_CBE 83.3455%-102 - C7 -1BHN NDKA1_BOVIN D:[5-151] --ERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFHPEELVNYKSCAQNWIY
86 PsiBlast_CBE 83.2753%-105 - C7 -4UOH ? B:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
58 PsiBlast_CBE 83.1854%-104 - C7 -1BE4 NDKA2_BOVIN B:[4-150] --ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFRPEELVNYKSCAQNWIY
110 HHSearch 83.1354% -87 - C7 -4FKX ? A:[10-158] PSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVESAKREIAFWFKAEELVSWTSHSVKQIY
14 PsiBlast_PDB 82.8553%-113 - C7 -1ZS6 NDK3_HUMAN A:[22-168] --ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLY
91 PsiBlast_CBE 82.8253%-105 - C7 -4UOF ? B:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
85 PsiBlast_CBE 82.7153%-107 - C7 -4UOH ? C:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
88 PsiBlast_CBE 82.5753%-104 - C7 -4UOG ? B:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
73 PsiBlast_CBE 82.5752%-102 - C7 -3BBB NDKB_HUMAN E:[4-150] --ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
92 PsiBlast_CBE 82.5153%-102 - C7 -4UOF ? A:[4-150] --ERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIY
75 PsiBlast_CBE 82.5052%-103 - C7 -