@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu23490: (2016-07-06 )
MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE

Atome Classification :

(75 SA) .........10.....-...20........30........40.........50........60........70........80........90........100.......110.......120.......130---..-.---.-...140.......150.......160.......170.--..--.--...180.......190.......200.......210.......220.......230.......240--.----......-----..250.......260.......270
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKDRIERAAAFIKQNL-PESPKIGLILGSGLGILADEIENP-VKLKYEDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFRAGDLMIITDHIN---FM-G---T-NPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDL--NI--P--IQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILD----Q----PLSHDE-----VMEVTEKVKAGFLKLVKAIVAQYE
2 PsiBlast_PDB 94.5856%-129 - C3 -3LBA ? A:[40-302] ---KIYETRDFLTAKG-VQKPEFGLILGSGLGELAEEIENA-LVLNYADIPNWGRS------GKLIYGELAGRKVLALQGRFHYYEGNSMELVTFPIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LT-G---A-NPLMGENLDDFGFRFPDMSNAYTADYREVAHQVADKI--GI--K--LDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGFQS----E-----LN--------VVAVTQQIKEDFKGLVKAILVE--
104 HHSearch 93.8751%-126 - C3 -4M1E ? A:[27-296] -KSRIDQATAKISQLW-QGEPAVGMILGTGLGGLAEQIEQD-IAIPYSDIPHFPTSTVKSHAGRLVCGRLRGIPIVAMEGRFHYYEGYSLEQVTFPVRVMKAMGVKTLLVTNAAGGINPQLDLSDVLIIEDHIN---LM-P---E-NPLRGPNDEELGPRFPDMSHPYDCQHMEVARQVALEL--GI--H--CPKGVFVAVSGPNLETRAEYRMLKLMGADVVGMSTVPEVLVAVHAGLRVLGFSVVTDLCLPDAL----E----PVELNK-----ILEVAARGGAKLARLIPEILPRIA
111 HHSearch 93.5746%-102 - C3 -2P4S ? A:[93-367] --DTLQEIATYLLERT-ELRPKVGIICGSGLGTLAEQLTDV-DSFDYETIPHFPVSTVAGHVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKYRVGDIMLIKDHIN---LM-GFAGN-NPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQI--GIENE--LREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITNMCTMSYEEE--E----EHCHDS-----IVGVGKNREKTLGEFVSRIVKHI-
4 PsiBlast_PDB 93.4249%-104 - C3 -4NSN ? A:[26-295] QEQHYHEAASFLSSRL-PGDAKTAIILGSGLGELAEKIENK-TVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHIN---NL-----P-NPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQEL--NI--P--VKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFAD----D----FVNDEQDVIRAANAASEKMGAIFARLIAAV-----
3 PsiBlast_PDB 92.9849%-110 - C3 -4NS1 ? A:[26-295] QEQHYHEAASFLSSRL-PGDAKTAIILGSGLGELAEKIENK-TVIPYNEIPHFAQA-----KGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHIN---NL-----P-NPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQEL--NI--P--VKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFAD----D----FVNDEQDVIRAANAASEKMGAIFARLIAAV-----
101 HHSearch 92.6452%-111 - C3 -4NSN ? A:[29-295] ---HYHEAASFLSSRL-PGDAKTAIILGSGLGELAEKIENK-TVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHIN---NL-P-----NPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQEL--NI--P--VKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFADD---F----VNDEQD-----VIRAANAASEKMGAIFARLIAAV-
44 PsiBlast_CBE 90.9447% -79 - C3 -3K8O PNPH_HUMAN S:[11-280] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
107 HHSearch 90.8857%-142 - C3 -3LA8 ? A:[39-303] --KKIYETRDFLTAKG-VQKPEFGLILGSGLGELAEEIENA-LVLNYADIPNWG---------KLIYGELAGRKVLALQ-RFHYYEG-SMELVTFPIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LT-G---A-NPLMG-NLDDFGFRFPDMSNAYTADYREVAHQVADKI--GI--K--LDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGF-----------------------VAVTQQIKEDFKGLVKAILVEL-
102 HHSearch 90.7848% -90 - C3 -3FUC PNPH_BOVIN A:[8-283] --EDYQDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHIN---LP-GFSGE-NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQM--GEQRE--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQ--G----KANHEE-----VLEAGKQAAQKLEQFVSLLMASIP
69 PsiBlast_CBE 90.3847% -82 - C3 -3PHB PNPH_HUMAN S:[46-315] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
66 PsiBlast_CBE 90.2747% -78 - C3 -3PHB PNPH_HUMAN Y:[46-315] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
46 PsiBlast_CBE 90.0447% -77 - C3 -3K8O PNPH_HUMAN E:[11-280] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
41 PsiBlast_CBE 89.8647% -85 - C3 -3K8O PNPH_HUMAN Y:[11-280] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
43 PsiBlast_CBE 89.8247% -81 - C3 -3K8O PNPH_HUMAN T:[11-280] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
108 HHSearch 89.8049% -86 - C3 -4LNA ? A:[24-293] -FEQIQETTQFIQSKI-TLRPAIGIILGTGLGALTNELDID-TTIPYETIPHFPLSTV---SGKLLIGTLGGKSVVVMQGRFHYYEGYTMQQVTYPVRVMHALGIQTLLVSNAAGGMNPTFQTSDLMVIDDHIS---LLLP---Q-NPLICPNPPIFGDRFPDMSEPYRKSLIDLAFSVAAEL--DI--P--LKRGVYVSVTGPQLETRAEYRMLRQWGADAVGMSTVPEVIVANQLGMDVFGISVITDLCFPDTL----E----KAELVK-----ILATAAQAEPKLTMLIREMIGRL-
18 PsiBlast_PDB 89.7948% -74 - C3 -1B8N PNPH_BOVIN A:[11-279] -----QDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-G---E-NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----YESQGKANHEE-----VLEAGKQAAQKLEQFVSLLM----
1 PsiBlast_PDB 89.5956%-140 - C3 -3LA8 ? A:[40-302] ---KIYETRDFLTAKG-VQKPEFGLILGSGLGELAEEIENA-LVLNYADIPNWG---------KLIYGELAGRKVLALQ-RFHYYEG-SMELVTFPIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHIN---LT-G---A-NPLMG-NLDDFGFRFPDMSNAYTADYREVAHQVADKI--GI--K--LDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGF-----------------------VAVTQQIKEDFKGLVKAILVE--
15 PsiBlast_PDB 89.5248% -90 - C3 -2AI1 PNPH_BOVIN A:[11-280] -----QDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-G---E-NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----YESQGKANHEE-----VLEAGKQAAQKLEQFVSLLMA---
67 PsiBlast_CBE 89.4947% -78 - C3 -3PHB PNPH_HUMAN U:[46-315] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
37 PsiBlast_CBE 89.3848% -75 - C3 -1A9T PNPH_BOVIN A:[11-280] -----QDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-G---E-NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----TESQGKANHEE-----VLEAGKQAAQKLEQFVSLLMA---
7 PsiBlast_PDB 89.2148% -76 - C3 -1FXU PNPH_BOVIN A:[11-280] -----QDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----TG---KANHEE-----VLEAGKQAAQKLEQFVSLLMA---
97 PsiBlast_CBE 89.0646% -96 - C3 -3GGS PNPH_HUMAN B:[33-302] -----KNTAEWLLSHT-KHRPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFS-G---Q-NPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR--E--LQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKV--IMDYESLE----KANHEE-----VLAAGKQAAQKLEQFVSILMA---
17 PsiBlast_PDB 89.0348% -89 - C3 -2AI3 PNPH_BOVIN A:[11-280] -----QDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPES------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-G---E-NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----Y----KANHEE-----VLEAGKQAAQKLEQFVSLLMA---
19 PsiBlast_PDB 88.9448% -75 - C3 -1B8O PNPH_BOVIN A:[11-280] -----QDTAKWLLSHT-EQRPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFS-G---E-NPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQR--E--LQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKV--IMD----YESQGKANHEE-----VLEAGKQAAQKLEQFVSLLMA---