@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu23620: (2016-07-06 )
MRKRKLGTSDLDISEVGLGCMSLGTEKNKALSILDEAIELGINYLDTADLYDRGRNEEIVGDAIQNRRHDIILATKAGNRWDDGSEGWYWDPSKAYIKEAVKKSLTRLKTDYIDLYQLHGGTIEDNIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYVKKSNIVSIMMQFSLFDRRPEEWLPLLEEHQISVVARGPVAKGLLTEKPLDQASESMKQNGYLSYSFEELTNARKAMEEVAPDLSMTEKSLQYLLAQPAVASVITGASKIEQLRENIQAANARRLTEEEIKALQSHTKQDIYKAHRS

Atome Classification :

(20 SA) .........10........20-...---..-------...30.---.......40........50--..-------......60.....----.----..70.......-.80..--..--.---...90........100.......110.......120....-----------------....130.......140.......150.---....---..160----.------.......170-........180--........190.......200.......210.--.-.....----220..---.---.---...230..----......240--.-----..--......250.......260.......270.......280.......290.......300....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRKRKLGTSDLDISEVGLGCM-SLG---TE-------KNKALS---ILDEAIELGINYLDTADLY--DR-------GRNEEIVGDAIQN----R----RHDIILATKAG-NRWDD--GS--E---GWYWDPSKAYIKEAVKKSLTRLKTDYIDLYQLHG-GTIED-----------------NIDETIEAFEELKQEGVIRYYGISSIRP---NVIK---EYVK-----K------SNIVSIMMQ--FSLFDRRPE-E--WLPLLEEHQISVVARGPVAKGLLTEKPLDQAS--E-SMKQN----GYLSY---S---F---EELT-NAR----KAMEEVA----P-----DL--SMTEKSLQYLLAQPAVASVITGASKIEQLRENIQAANARRLTEEEIKALQSHTKQDIYKAHRS
2 PsiBlast_PDB 96.4263%-109 - C3 -1YNQ ? A:[21-316] MKKRQLGTSDLHVSELGFGCM-SLG---TD-------ETKARR---IMDEVLELGINYLDTADLY--NQ-------GLNEQFVGKALKG----R----RQDIILATKV------------------WWWDPSKAYIKEAVKDSLRRLQTDYIDLYQLHG-GTIDD-----------------PIDETIEAFEELKQEGVIRYYGISSIRP---NVIK---EYLK-----R------SNIVSIMMQ--YSILDRRPE-E--WFPLIQEHGVSVVVRGPVARGLLSRRPLPEG---------E----GYLNY---R---Y---DELK-LLR-------ESLP----T-----DR--PLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHR-
21 PsiBlast_CBE 96.2763% -96 - C3 -1YNQ ? B:[21-316] MKKRQLGTSDLHVSELGFGCM-SLG---TD-------ETKARR---IMDEVLELGINYLDTADLY--NQ-------GLNEQFVGKALKG----R----RQDIILATKVG-NRFEQ--GK--E---GWWWDPSKAYIKEAVKDSLRRLQTDYIDLYQLHG-GTIDD-----------------PIDETIEAFEELKQEGVIRYYGISSIRP---NVIK---EYLK-----R------SNIVSIMMQ--YSILDRRPE-E--WFPLIQEHGVSVVVRGPVARGLLSRRPLPEG---------E----GYLNY---R---Y---DELK-LLR-------ESLP----T-----DR--PLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHR-
22 PsiBlast_CBE 95.4763% -95 - C3 -1YNP ? B:[21-316] MKKRQLGTSDLHVSELGFGCM-SLG---TD-------ETKARR---IMDEVLELGINYLDTADLY--NQ-------GLNEQFVGKALKG----R----RQDIILATKVG-NRFEQ--GK--E---GWWWDPSKAYIKEAVKDSLRRLQTDYIDLYQLHG-GTIDD-----------------PIDETIEAFEELKQEGVIRYYGISSIRP---NVIK---EYLK-----R------SNIVSIMMQ--YSILDRRPE-E--WFPLIQEHGVSVVVRGPVARGLLSRRPLPEG---------E----GYLNY---R---Y---DELK-LLR-------ESLP----T-----DR--PLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHR-
1 PsiBlast_PDB 94.2563%-116 - C3 -1YNP ? A:[21-316] MKKRQLGTSDLHVSELGFGCM-SLG---TD-------ETKARR---IMDEVLELGINYLDTADLY--NQ-------GLNEQFVGKALKG----R----RQDIILATKV-----------------------SKAYIKEAVKDSLRRLQTDYIDLYQLHG-GTIDD-----------------PIDETIEAFEELKQEGVIRYYGISSIRP---NVIK---EYLK-----R------SNIVSIMMQ--YSILDRRPE-E--WFPLIQEHGVSVVVRGPVARGLLSRRPLPEG---------E----GYLNY---R---Y---DELK-LLR-------ESLP----T-----DR--PLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHR-
43 HHSearch 87.3864% -89 - C3 -1YNP ? A:[21-317] MKKRQLGTSDLHVSELGFGCM-SLG---TD-------ETKARR---IMDEVLELGINYLDTADLY--NQ-------GLNEQFVGKALKG----R----RQDIILATKV-----------------------SKAYIKEAVKDSLRRLQTDYIDLYQLHG-GTIDD-----------------PIDETIEAFEELKQEGVIRYYGISSIRP---NVIK---EYLK-----R------SNIVSIMMQ--YSILDRRPE-E--WFPLIQEHGVSVVVRGPVARGLLSRRPLPEGE-----------------------------GYLN-YRY----DELKLLRESLPT-----DR--PLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE
52 HHSearch 59.0929% 32 - C3 -3N6Q GPR_ECOLI A:[13-336] MQYRYCGKSGLRLPALSLGLW-HNF---GHVNA----LESQRA---ILRKAFDLGITHFDLANNY--GPPP-----GSAEENFGRLLREDFAAY----RDELIISTKAG-YDMWP------G---PYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHR-VDENT-----------------PMEETASALAHAVQSGKALYVGISSYSP---ERTQ---KMVELLREWK------IPLLIHQPS--YNLLNRWVDKSG-LLDTLQNNGVGCIAFTPLAQGLLTGKYL-------------------------L---T---EANL-NSL----RLLNEMAQQ--R-----GQ--SMAQMALSWLLKDDRVTSVLIGASRAEQLEENVQALNNLTFSTKELAQIDQHIADGE------
57 HHSearch 59.0728% 4 - C3 -4WGH ? A:[25-301] KKTVRFGE-QAAVPAIGLGTW-YMG---EHAAQ----RQQEVA---ALRAGIDHGLTVIDTAEMY--AD-------GGAEEVVGQAIRG----L----RDRVVLVSKVY-PW-----------------HAGKAAMHRACENSLRRLQTDYLDMYLLHW-RGDI------------------PLQETVEAMEKLVAEGKIRRWGVSNLDT---EDMQ---ALWRTAD--G------EHCATNQVL--YHLASRGIE-YD-LLPWCQQHSLPVMAYCPLAQAGRLRDGLF--------------------------------Q------H----SDIINMANA--R-----GI--TVAQLLLAWVIRHPGVL-AIPKAASIEHVVQNAAALD-IVLSGEELAQLDRLYPPPQRKN---
45 HHSearch 58.9230% 59 - C3 -1LQA TAS_ECOLI A:[1-345] MQYHRIPHSSLEVSTLGLGTM-TFG---EQNS-----EADAHA---QLDYAVAQGINLIDVAEMY--PVPPRPETQGLTETYVGNWLAK----HGS--REKLIIASKVS-GPSRN--NDKGI---RPDQALDRKNIREALHDSLKRLQTDYLDLYQVHW-PQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETA---FGVM---RYLH-----LADKHDLPRIVTIQNP--YSLLNRSFE-VG-LAEVSQYEGVELLAYSCLGFGTLTGKYLNGAK--P-AGARNTLFSRFTRY---S---G---EQTQ-KAV----AAYVDIARR--H-----GL--DPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLH-LELSEDVLAEIEAVHQVYTYPA---
50 HHSearch 58.7432% 50 - C3 -1PYF IOLS_BACSU A:[2-311] -KKAKLGKSDLQVFPIGLGTN-AVG---GHNLYPNLNEETGKE---LVREAIRNGVTMLDTAYIY--GI-------GRSEELIGEVLRE----FN---REDVVIATKAA-HRKQG--N-------DFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHF-PDEHT-----------------PKDEAVNALNEMKKAGKIRSIGVSNFSL---EQLK---EANK-----D------GLVDVLQGE--YNLLNREAE-KT-FFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPE-GDLRN----EQEHF---KGERF---KENI-RKV----NKLAPIAEK--H-----NV--DIPHIVLAWYLARPEIDILIPGAKRADQLIDNIKTAD-VTLSQEDISFIDKLFAP--------
54 HHSearch 58.1226% 33 - C3 -3ERP ? A:[34-351] MEYRRCGRSGVKLPAISLGLW-HNF---GDTTR----VENSRA---LLQRAFDLGITHFDLANNY--GPPP-----GSAECNFGRILQEDFLPW----RDELIISTKAG-YTMWD------G---PYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHR-PDPET-----------------PLKETMKALDHLVRHGKALYVGISNYPA---DLAR---QAID-----ILEDLG-TPCLIHQPK--YSLFERWVE-DG-LLALLQEKGVGSIAFSPLAGGQLTDRYLN------------------------I---T---ADKL-EKV----RRLNELAAR--R-----GQ--KLSQMALAWVLRNDNVTSVLIGASKPSQIEDAVGMLANRRFSAAECAEIDAILEG--------
4 PsiBlast_PDB 57.7330% 61 - C3 -1PZ0 IOLS_BACSU A:[2-302] -KKAKLGKSDLQVFPIGLGTN-AVG---GHNLYPNLNEETGKE---LVREAIRNGVTMLDTAYIY--GI-------GRSEELIGEVLREF---N----REDVVIATKAA-HR-KQ--GN--D----FVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHF-PDEHT-----------------PKDEAVNALNEMKKAGKIRSIGVSNFSL---EQLK---EANK-----D------GLVDVLQGE--YNLLNREAE-KT-FFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPE-GDLRN----EQEHF---K---G---ERFK-ENI----RKVNKLA----PIAEKHNV--DIPHIVLAWYLARPEIDILIPGAKRADQLIDNIKTADV-TLSQEDI-----------------
3 PsiBlast_PDB 57.3130% 61 - C3 -1PYF IOLS_BACSU A:[2-302] -KKAKLGKSDLQVFPIGLGTN-AVG---GHNLYPNLNEETGKE---LVREAIRNGVTMLDTAYIY--GI-------GRSEELIGEVLREF---N----REDVVIATKAA-HR-KQ--GN--D----FVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHF-PDEHT-----------------PKDEAVNALNEMKKAGKIRSIGVSNFSL---EQLK---EANK-----D------GLVDVLQGE--YNLLNREAE-KT-FFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPE-GDLRN----EQEHF---K---G---ERFK-ENI----RKVNKLA----PIAEKHNV--DIPHIVLAWYLARPEIDILIPGAKRADQLIDNIKTADV-TLSQEDI-----------------
12 PsiBlast_PDB 56.4227% -8 - C3 -4WGH ? A:[36-277] ------------VPAIGLGTW-YMGEHAAQ-------RQQEVA---ALRAGIDHGLTVIDTAEMY--AD-------GGAEEVVGQAIRG----L----RDRVVLVSKV------------------YPWHAGKAAMHRACENSLRRLQTDYLDMYLLHWRGDIP-------------------LQETVEAMEKLVAEGKIRRWGVSNLDTEDMQALW---RTAD-----G------EHCATNQVL--YHLASRGIEYD--LLPWCQQHSLPVMAYCPLAQAGRLRDGLFQHS--D-IINM------------------------A-NAR---------------------GI--TVAQLLLAWVIRHPGVLAIPKAAS-IEHVVQNAAA----------------------------
56 HHSearch 55.9128% 22 - C3 -5C7H ? A:[5-275] IPTIAFP-DGRKVPALGQGTW-RMG---ENRAK----TADEVR---SLQTGLDLGMTLIDTAEMY--GD-------GAAERIVGEAIKG----R----RDEAFVVSKVL-PS-----------------NASRAGTVAACERSLRNLGIDCVDLYLLHW-RGGY------------------PLAETVAAFEELKKAGKIRAWGVSNFDV---DDME---ELSAVPD--G------GNVAANQVL--YNLARRGIE-FD-LLPRCRAQGVPVMAYSPLDEGRLLHDA-----------------------------------------------DLIHIAKA--H-----QA--TPAQVALAFLKTCSGV-ISIPKTGSPERARENRDAMD-IHLTTENLAELDRHFPPPRRK----
49 HHSearch 55.0029% 57 - C3 -3N2T - ? A:[3-316] SDTIRIPGIDTPLSRVALGTW-AIG---GWMWGGPD-DDNGVR---TIHAALDEGINLIDTAPVY--GF-------GHSEEIVGRALAE----K----PNKAHVATKLG-LHWVG--ED--EKNMKVFRDSRPARIRKEVEDSLRRLRVETIDLEQIHW-PDDKT-----------------PIDESARELQKLHQDGKIRALGVSNFSP---EQMD---IFRE-----V------APLATIQPP--LNLFERTIE-KD-ILPYAEKHNAVVLAYGALCRGLLTGKMNRDTTFPK-DDLRS----NDPKFQKPN---F---EKYL-AAM----DEFEKLAEK--R-----GK--SVMAFAVRWVLDQGPV-IALWGARKPGQVSGVKDVFG-WSLTDEEKKAVDDILARH-------
58 HHSearch 54.9526% -3 - C3 -4Q3M ? A:[2-264] -HSVKLNN-NYEMPIIGLGTF-RSK------------KNDAYN---AVKAALEGGYRHIDTAMIY--GN----------EEEVGRAIKD----SNIP-REEIFVTTKLW-NT-----------------DQGYEKTLEAFNTSLKNLGLDYIDLYLIHW-FKGYD-----------------NALSTYRAFETLYEEGKVKAIGVSNFNV---HHLM---YLME-----NAK----IPPMVNQVE--THVTLQNH--F--LHDYCKKNNIQLEAYAPLMSHQIKDLLS----------------------------------------N----ETMAKIAKK--H-----DK--TIPQIAIRWLIEREI--VVIPKSITPERIVQNFDVFD-FTLDEEDMKSIRSVNTGKK------
11 PsiBlast_PDB 54.7526% 61 - C3 -3ERP ? A:[34-342] MEYRRCGRSGVKLPAISLGLWHNFGDT-TR-------VENSRA---LLQRAFDLGITHFDLANNYGPPP-------GSAECNFGRILQE----DFLPWRDELIISTKAGYTMWDG--PY--G---DW---GSRKYLIASLDQSLKRMGLEYVDIFYHHR-PDPET-----------------PLKETMKALDHLVRHGKALYVGISNYPA---DLAR---QAIDILEDLG------TPCLIHQPK--YSLFERWVE-DG-LLALLQEKGVGSIAFSPLAGGQLTDRYLN----------------------------------IT-ADKLEKVRRLNELA----ARR---GQ--KLSQMALAWVLRNDNVTSVLIGASKPSQIEDAVGMLANRRFSAAEC-----------------
48 HHSearch 54.6130% 61 - C3 -1PZ1 GS69_BACSU A:[1-314] MEYTSIADTGIEASRIGLGTW-AIG---GTMWGGTD-EKTSIE---TIRAALDQGITLIDTAPAY--GF-------GQSEEIVGKAIKE----YMK--RDQVILATKTA-LDWKN--N-------QLFRHANRARIVEEVENSLKRLQTDYIDLYQVHW-PDPLV-----------------PIEETAEVMKELYDAGKIRAIGVSNFSI---EQMD---TFRA-----V------APLHTIQPP--YNLFEREME-ES-VLPYAKDNKITTLLYGSLCRGLLTGKMTEEYTF-EGDDLRN----HDPKF---Q---KPRFKEYL-SAV----NQLDKLAKTR-Y-----GK--SVIHLAVRWILDQPGADIALWGARKPGQLEALSEITG-WTLNSEDQKDINTILENTI------
9 PsiBlast_PDB 54.5029% 41 - C3 -3N6Q GPR_ECOLI A:[13-331] MQYRYCGKSGLRLPALSLGLW-HNF---GH-------VNALESQRAILRKAFDLGITHFDLANNY--GPPP-----GSAEENFGRLLREDFAAY----RDELIISTKAGYDMWPGPYGS--G---G-----SRKYLLASLDQSLKRMGLEYVDIFYSHR-VDENT-----------------PMEETASALAHAVQSGKALYVGISSYSP---ERTQKMVELLR-----E------WKIPLLIHQPSYNLLNRWVD-KSGLLDTLQNNGVGCIAFTPLAQGLLTGKYL-----------------------------L---TEANLNSL----RLLNEMA----Q-----QRGQSMAQMALSWLLKDDRVTSVLIGASRAEQLEENVQALNNLTFSTKELAQIDQH-----------