@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu23860: (2016-07-07 )
MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQEAKGKNVVGTYSIEEFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAESGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLISESYFILKQVLGLSADELHEVFAEWNKGELDSYLIEITADIFTKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVKASGLLSGPEVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIAMIFRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVESYQGALRQVISLAVAQGVPVPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK

Atome Classification :

(29 SA) .........10........20........30........40..-....-..-50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.--......170.......180.......190.......200......-.210.......220.......230.......240.......250.......260.......270.......280.......290.......300......-.-310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460------...-......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFL-QEAK-GK-NVVGTYSIEEFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAESGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKV--DGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLISESYFILKQVLG-LSADELHEVFAEWNKGELDSYLIEITADIFTKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVKASGLLSGPEV-K-PVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIAMIFRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVESYQGALRQVISLAVAQGVPVPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKE--------GIF-HTEWMK
22 PsiBlast_CBE 88.7883%-101 - C2 -2W90 ? B:[3-471] MAKHQIGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFL-QEAK-GK-NIVGTYSIEEFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKV--DGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAYFLLKHVLG-MDAAELHEVFADWNKGELNSYLIEITADIFTKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVKASKVLAGPAV-K-PFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIAMIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDSYFKDIVERYQDALREIVATAAMRGIPVPGSASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKE--------GIF-HTEWLK
2 PsiBlast_PDB 87.9083%-102 - C2 -2W90 ? A:[3-471] MAKHQIGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFL-QEAK-GK-NIVGTYSIEEFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKV--DGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAYFLLKHVLG-MDAAELHEVFADWNKGELNSYLIEITADIFTKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVKASKVLAGPAV-K-PFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIAMIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDSYFKDIVERYQDALREIVATAAMRGIPVPGSASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKE--------GIF-HTEWLK
1 PsiBlast_PDB 87.8383% -99 - C2 -2W8Z ? A:[3-470] -AKHQIGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFL-QEAK-GK-NIVGTYSIEEFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKV--DGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAYFLLKHVLG-MDAAELHEVFADWNKGELNSYLIEITADIFTKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVKASKVLAGPAV-K-PFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIAMIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDSYFKDIVERYQDALREIVATAAMRGIPVPGSASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKE--------GIF-HTEWLK
21 PsiBlast_CBE 87.3583%-100 - C2 -2W8Z ? B:[3-469] -AKHQIGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFL-QEAK-GK-NIVGTYSIEEFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKV--DGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAYFLLKHVLG-MDAAELHEVFADWNKGELNSYLIEITADIFTKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVKASKVLAGPAV-K-PFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIAMIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDSYFKDIVERYQDALREIVATAAMRGIPVPGSASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKE--------GIF-HTEWL-
23 PsiBlast_CBE 82.5970% -44 - C2 -3FWN 6PGD_ECOLI B:[14-479] -SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVI-AENP-GK-KLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLN-LTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDED-GNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q-PAGD-KAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQIGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKE--------GVF-HTEWL-
24 PsiBlast_CBE 82.5169% -42 - C2 -2ZYD 6PGD_ECOLI B:[14-479] -SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVI-AENP-GK-KLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLN-LTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDED-GNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q-PAGD-KAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKE--------GVF-HTEWL-
6 PsiBlast_PDB 82.4669% -48 - C2 -2ZYD 6PGD_ECOLI A:[15-478] --KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVI-AENP-GK-KLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLN-LTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDED-GNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q-PAGD-KAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKE--------GVF-HTEW--
65 HHSearch 82.1170% -48 - C2 -2ZYD 6PGD_ECOLI A:[15-478] --KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVI-AENP-GK-KLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLN-LTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDE-DGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q--PAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKE--------GVF-HTEW--
5 PsiBlast_PDB 81.9269% -45 - C2 -2ZYA 6PGD_ECOLI A:[14-478] -SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVI-AENP-GK-KLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLN-LTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDED-GNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q-PAGD-KAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKE--------GVF-HTEW--
4 PsiBlast_PDB 81.9070% -49 - C2 -3FWN 6PGD_ECOLI A:[14-479] -SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVI-AENP-GK-KLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLN-LTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDED-GNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q-PAGD-KAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQIGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKE--------GVF-HTEWL-
3 PsiBlast_PDB 81.1470% -44 - C2 -2ZYG - ? A:[3-468] --KQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVI-AENP-GK-KLVPYYTVQEFVESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGPSIMPGGQKEAYELVAPILKQIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLKGGLA-LSNEELAQTFTEWNEGELSSYLIDITKDIFTKKDEE-GKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q-PAG-DKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKE--------GIF-HTEWLE
25 PsiBlast_CBE 80.8269% -43 - C2 -2ZYA 6PGD_ECOLI B:[14-479] -SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVI-AENP-GK-KLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAE-DGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLN-LTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDED-GNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQA-Q-PAGD-KAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKE--------GVF-HTEWL-
8 PsiBlast_PDB 79.6067% -27 - C2 -2IYO 6PGD_LACLM A:[1-468] MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVF-KEHQ-DK-NLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILG-LSNAEIQAIFEEWNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVKASKVLSGPAL-D--FSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKA--------GIF-HYDW--
29 PsiBlast_CBE 79.4767% -26 - C2 -2IZ1 6PGD_LACLM B:[3-470] MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVF-KEHQ-DK-NLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILG-LSNAEIQAIFEEWNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVKASKVLSGPAL-D--FSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKA--------GIF-HYDW--
10 PsiBlast_PDB 79.2567% -27 - C2 -2IZ1 6PGD_LACLM A:[3-470] MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVF-KEHQ-DK-NLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILG-LSNAEIQAIFEEWNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVKASKVLSGPAL-D--FSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKA--------GIF-HYDW--
66 HHSearch 79.0267% -27 * C2 *2IZ1 6PGD_LACLM A:[3-472] MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVF-KEHQ-DK-NLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILG-LSNAEIQAIFEEWNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVKASKVLSGPAL-D--FSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKA--------GIF-HYDWYT
9 PsiBlast_PDB 78.5867% -26 - C2 -2IZ0 6PGD_LACLM A:[3-470] MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVF-KEHQ-DK-NLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILG-LSNAEIQAIFEEWNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVKASKVLSGPAL-D--FSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKA--------GIF-HYDW--
30 PsiBlast_CBE 78.3767% -29 - C2 -2IZ0 6PGD_LACLM C:[4-470] -AQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVF-KEHQ-DK-NLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILG-LSNAEIQAIFEEWNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVKASKVLSGPAL-D--FSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKA--------GIF-HYDW--
26 PsiBlast_CBE 78.3367% -30 - C2 -2IYP 6PGD_LACLM C:[3-469] -AQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVF-KEHQ-DK-NLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILG-LSNAEIQAIFEEWNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVKASKVLSGPAL-D--FSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKA--------GIF-HYDW--