@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu25160: (2016-07-09 )
MDVIKISPRGYCYGVVDAMVIAKNASLDKSLPRPIYILGMIVHNKHVTDAFEEEGIFTLDGSNRLDILKQVDKGTVIFTAHGVSPEVRRIAEEKGLVAIDATCPDVTKTHNLILEMKEKGYHVIYIGKKGHPEPEGAVGVAPEIVHLVETEEDVKNLDIQSEKLIVTNQTTMSQWDVHDIMELVKEKYPHVEYHQEICLATQVRQEAVSEQAKKADLTIVVGDPKSNNSNRLAQVSEEIAGTKAYRIGDLSELKLEWLKGVNTVAVTAGASTPTPITKEVIRFLEQFDHEDPSTWTTEHNIPLKKILPKVKAKN

Atome Classification :

(63 SA) -.........10........20........30........40........50........60...-.....70...-.....80........90........100.......110.......-120.......130.......--140---.---...---...150.......160-........170.......180.......190.--..--......200.......210.......220.......230.......240.......250.......260.......270.......280.---------.....--.290-........300.......310..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MDVIKISPRGYCYGVVDAMVIAKNASLDKSLPRPIYILGMIVHNKHVTDAFEEEGIFTLDGSNR-LDILKQVDKG-TVIFTAHGVSPEVRRIAEEKGLVAIDATCPDVTKTHNLILEMKEK-GYHVIYIGKKGHPEPEGAVG--VAP---E---IVH---LVETEEDVKNLDIQ-S-EKLIVTNQTTMSQWDVHDIMELVKEKYPH--V--EY--HQEICLATQVRQEAVSEQAKKADLTIVVGDPKSNNSNRLAQVSEEIAGTKAYRIGDLSELKLEWLKGVNTVAVTAGASTPTPITKEVIRF---------LEQFD--HED--PSTWTTEHNIPLKKILPKVKAKN
77 PsiBlast_CBE 85.3536% -38 - C9 -4N7B ? A:[225-526] ------INPRGFCKGVSRAIETVEECL--KLFKPPIYVKHKIVHNDIVCKKLEKEGAIFIEDLND-VP-----DGH-ILIYSAHGISPQIREIAKKKKLIEIDATCPLVNKVH-VYVQMKAKENYDIILIGYKNHVEVIGTYN--EAP---H---CTH---IVENVNDVDKLNFPLN-KKLFYVTQTTLSMDDCALIVQKLKNKFPH--I--ETIPSGSICYATTNRQTALNKICTKCDLTIVVGSSSSSNAKKLV-YSSQIRNVPAVLLNTVHDLDQQILKNVNKIALTSAASTPEQETQKFVNLLTNPPFNYTLQNFDGAHEN--VPKWKLPKNF-------------
73 PsiBlast_CBE 84.1237% -38 - C9 -3T0F ISPH_ECOLI B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAG------TMGQ--------G--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
51 PsiBlast_CBE 83.4438% -13 - C9 -3UWM ISPH_ECOLI B:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
56 PsiBlast_CBE 83.3538% -14 - C9 -3UTC ISPH_ECOLI B:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
25 PsiBlast_PDB 83.0238% -15 - C9 -4MV5 ? A:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
3 HHSearch 83.0135% -14 - C9 -4N7B ? A:[220-519] -KILYLINPRGFCKGVSRAIETVEECLKL--FKPPIYVKHKIVHNDIVCKKLEKEGAIFIED-LNDVP-----DGH-ILIYSAHGISPQIREIAKKKKLIEIDATCPLVNKVHVYVQMKAKE-NYDIILIGYKNHVEVIGTYN--EAP---H---CTH---IVENVNDVDKLNFP-LNKKLFYVTQTTLSMDDCALIVQKLKNKFPHIET--IP--SGSICYATTNRQTALNKICTKCDLTIVVGSSSSSNAKKLVYSSQIR-NVPAVLLNTVHDLDQQILKNVNKIALTSAASTPEQETQKFVNL---------LTNPP--FNYTLQNFDGAHENVPK-----------
43 PsiBlast_CBE 82.7738% -15 - C9 -4MUY ? B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
61 PsiBlast_CBE 82.6838% -14 - C9 -3KEL ISPH_ECOLI A:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
24 PsiBlast_PDB 82.6738% -12 - C9 -4MUX ? A:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
45 PsiBlast_CBE 82.6338% -15 - C9 -4EB3 ISPH_ECOLI B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
40 PsiBlast_PDB 82.6338% -15 - C9 -3KEF ISPH_ECOLI A:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
32 PsiBlast_PDB 82.6238% -14 - C9 -3UTC ISPH_ECOLI A:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
67 PsiBlast_CBE 82.6138% -15 - C9 -4H4D ISPH_ECOLI B:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
64 PsiBlast_CBE 82.5838% -14 - C9 -3KE8 ISPH_ECOLI B:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
54 PsiBlast_CBE 82.4838% -14 - C9 -3UV3 ISPH_ECOLI B:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
48 PsiBlast_CBE 82.4838% -13 - C9 -3SZO ISPH_ECOLI B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
39 PsiBlast_PDB 82.4538% -14 - C9 -3KE9 ISPH_ECOLI A:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
49 PsiBlast_CBE 82.4138% -14 - C9 -3SZL ISPH_ECOLI B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
76 PsiBlast_CBE 82.3737% -16 - C9 -3T0G ISPH_ECOLI A:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQCTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
50 PsiBlast_CBE 82.3238% -15 - C9 -3F7T ISPH_ECOLI B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
23 PsiBlast_PDB 82.2738% -13 - C9 -4MV0 ? A:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
53 PsiBlast_CBE 82.2438% -17 - C9 -3UV6 ISPH_ECOLI B:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
69 PsiBlast_CBE 82.2138% -14 * C9 *4H4C ISPH_ECOLI B:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
52 PsiBlast_CBE 82.2138% -16 - C9 -3UV7 ISPH_ECOLI B:[9-293] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
38 PsiBlast_PDB 82.1938% -10 - C9 -3KE8 ISPH_ECOLI A:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
59 PsiBlast_CBE 82.1738% -14 - C9 -3KEM ISPH_ECOLI A:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
47 PsiBlast_CBE 82.1738% -12 - C9 -3ZGL ISPH_ECOLI B:[17-301] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
44 PsiBlast_CBE 82.1738% -14 - C9 -4MUX ? B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
58 PsiBlast_CBE 82.0938% -14 - C9 -3KEM ISPH_ECOLI B:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
60 PsiBlast_CBE 82.0438% -12 - C9 -3KEL ISPH_ECOLI B:[11-295] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
30 PsiBlast_PDB 82.0438% -13 - C9 -3SZO ISPH_ECOLI A:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
41 PsiBlast_CBE 81.9238% -13 - C9 -4MV5 ? B:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
27 PsiBlast_PDB 81.8738% -12 - C9 -3ZGN ISPH_ECOLI A:[17-301] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
72 PsiBlast_CBE 81.8237% -17 - C9 -3SZU ISPH_ECOLI A:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPQVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------
21 PsiBlast_PDB 81.8138% -11 - C9 -4EB3 ISPH_ECOLI A:[13-297] -MQILLANPRGFCAGVDRAISIVENAL--AIYGAPIYVRHEVVHNRYVVDSLRERGAIFIE------QISEVPDGA-ILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRR-GEESILIGHAGHPEVEGTMGQYSNP---EG--GMY---LVESPDDVWKLTVK-NEEKLSFMTQTTLSVDDTSDVIDALRKRFPK--IVGPR--KDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRM-GKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR---------LQQL-------------------------------