@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu25310: (2016-07-10 )
MDSKDHRNELNRFFKSFVHAGRGIWETARTERNFQFHAAAACAVLICGFLVELSIIEWMIIFLLIGGMFSLELLNTAIEHTVDLITDKHHPLAKAAKDAAAGAVCVFAVISCIIGLLIFLPKL

Atome Classification :

(20 SA) --------.........10........20........30........40........50........60........70........80........90........100.......110.......120.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --------MDSKDHRNELNRFFKSFVHAGRGIWETARTERNFQFHAAAACAVLICGFLVELSIIEWMIIFLLIGGMFSLELLNTAIEHTVDLITDKHHPLAKAAKDAAAGAVCVFAVISCIIGLLIFLPKL
64 HHSearch 69.7520%-194 * C11 *3ZE3 KDGL_ECOLI A:[15-129] ----------------GFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLCVVIAAWLDVDAVTRVLLISSVMLVMIVELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLIAIIDAVITWAILLWSHF
76 Fugue 62.3412% -71 - C- -2P61 - ? A:[34-153] EFFDILEDVKEDHFEKLLEEAVEEVIDSGNELVRSPTPSNLKRYKNAIKEFLKLIEKKIY-----------------KLNSGRARLHLVVEEVNEKLMDLTEKIMKNEWQTINLAARIEEINGLILNLYRE
17 PsiBlast_PDB 60.6622%-121 - C11 -4UP6 - KDGL_ECOLI A:[7-110] -----------------FTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVI----------
63 PsiBlast_CBE 59.8044%-111 * C13 *4CJZ KDGL_ECOLI C:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWCILL---
16 PsiBlast_PDB 58.9822%-125 - C11 -3ZE4 - KDGL_ECOLI A:[7-110] -----------------FTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVI----------
2 PsiBlast_PDB 58.8244% -95 - C13 -4BPD - KDGL_ECOLI A:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
42 PsiBlast_CBE 58.5444% -77 - C13 -4D2E KDGL_ECOLI B:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
38 PsiBlast_CBE 58.4244% -70 - C13 -4UXZ KDGL_ECOLI B:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
56 PsiBlast_CBE 58.2544% -83 - C13 -3ZE3 KDGL_ECOLI B:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
48 PsiBlast_CBE 58.1544% -80 - C13 -4BRB KDGL_ECOLI B:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
51 PsiBlast_CBE 58.1244% -84 - C13 -4BPD KDGL_ECOLI B:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
10 PsiBlast_PDB 58.0744% -70 - C13 -5DWK ? A:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
7 PsiBlast_PDB 57.7844% -95 - C13 -4UYO - KDGL_ECOLI A:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
30 PsiBlast_CBE 57.5844% -72 - C13 -5D56 KDGL_ECOLI C:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
44 PsiBlast_CBE 57.5644% -58 - C13 -4BRR KDGL_ECOLI C:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
27 PsiBlast_CBE 57.5444% -66 - C13 -5D57 KDGL_ECOLI B:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
55 PsiBlast_CBE 57.5244% -70 - C13 -3ZE3 KDGL_ECOLI C:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
25 PsiBlast_CBE 57.5044% -70 - C13 -5D57 KDGL_ECOLI D:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
40 PsiBlast_CBE 57.3744% -64 - C13 -4D2E KDGL_ECOLI D:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---
54 PsiBlast_CBE 57.1644% -43 - C13 -3ZE3 KDGL_ECOLI D:[77-125] ------------------------------------------------------------------------------VELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI-AIIDAVITWAILL---