@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu25660: (2016-07-10 )
MKKLYGVIGNPIGHSMSPDIHNASLKDLGLDGHYHAFKVEENDLEDAVKGIRALGVQGINVTVPHKVSIMDYLDHIDESAKVLGAVNTVRREGDKLVGYNTDGEGFVKSLMKVLDKPISELSFLMIGAGGAARAIFTTIVRNTPKKFDICNRTLEKAKRLTEATPSFHNKEVLSIKEAEERLEQYDVIIHTTSVGMYPNVDDVPLSLQRAASSAVVCDIVYNPIQTALLKEASQKGLKTLDGVGMFVEQAALSFQLWTGQEPNIEKMRSIVIGKLGGTEC

Atome Classification :

(57 SA) .........10........20....----....30---.........40........50.........60........70........80........-90-.--..-.....100.......110-..-......120.......130.....-----------..140.......150----------.---.---.....160......--.---170-.......---.-.180...-.....190-...---...-.-----.200...-.----..----.210.....-..220---.......230.....-.-.240.......250.......260---.....---...270.......280
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKKLYGVIGNPIGHSMSPDIHNASL----KDLGL----DGHYHAFKVEENDLEDAVKG-IRALGVQGINVTVPHKVSIMDYLDHIDESAKVLGAVNTV-RR-E--GD-KLVGYNTDGEGFVKSLM--KV-LDKPISELSFLMIGAGGAARAIFT-----------TIVRNTPKKFDICNR----------T---L---EKAKRLTEATPSFH--N---K---EVLSIKE---A-EE-RLEQ-YDVIIHT--TSV---GMY-P-----NVDDVPL-S----LQ----RAASSAVVC-DIVYN---PIQTALLKEASQKGL-K-TLDGVGMFVEQAALSFQLWTGQE----PNIEK---MRSIVIGKLGGTEC
1 PsiBlast_PDB 89.1445%-111 - C6 -2EGG AROE_GEOKA A:[22-295] MEKVYGLIGFPVEHSLSPLMHNDAF----ARLGI----PARYHLFSVEPGQVGAAIAG-VRALGIAGVNVTIPHKLAVIPFLDEVDEHARRIGAVNTI-IN-N--DG-RLVGYNTDGLGYVQALE--EE-MNITLDGKRILVIGAGGGARGIYF-----------SLLSTAAERIDMANR----------T---V---EKAERLVREGDE-R--R---S---AYFSLAE---A-ET-RLAE-YDIIINT--TSV---GMH-P-----RVEVQPL-S----LE----RLRPGVIVS-DIIYN---PLETKWLKEAKARGA-R-VQNGVGMLVYQGALAFEKWTGQW----PDVNR---MKQLVIEAL-----
120 HHSearch 87.9041%-120 - C6 -2HK9 AROE_AQUAE A:[11-271] QTQLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSLK--S--LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEG-AKVFLWNR----------T---K---EKAIKLAQKFPLE--------------VVNS---P-EE-VIDK-VQVIVNT--TSV---GLK-D-----ED-PEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE----VPYSV---AERSVR--------
5 PsiBlast_PDB 85.9942%-123 - C6 -2HK7 AROE_AQUAE A:[7-254] --QLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSL---KS-LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEGAKVF-LWNR----------T---K---EKAIKLAQKFP--------------LEVVNS---P-EE-VIDK-VQVIVNT--TSV---GL--K-----DEDPEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE--------------------------
25 PsiBlast_CBE 85.9242%-126 - C6 -2HK7 AROE_AQUAE B:[7-254] --QLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSL---KS-LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEGAKVF-LWNR----------T---K---EKAIKLAQKFP--------------LEVVNS---P-EE-VIDK-VQVIVNT--TSV---GL--K-----DEDPEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE--------------------------
114 HHSearch 85.8842%-109 - C6 -3DON AROE_STAEQ A:[1-268] --MKFAVIGNPISHSLSPLMHHANF----QSLNL----ENTYEAINVPVNQFQDIKKI-ISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVGAVNTV-LV-K--DG-KWIGYNTDGIGYVNGLK--Q--IYEGIEDAYILILGAGGASKGIAN-----------ELYKIVRPTLTVANR----------T---M---SRFNNWSLNINK--------------INLSH---A-ES-HLDE-FDIIINT--TP----------------D-SVI-S----LN----RLASHTLVS-DIVYN---PYKTPILIEAEQRGN-P-IYNGLDMFVHQGAESFKIWTNLE----PDIKA---MKNIVIQKLKGE--
6 PsiBlast_PDB 85.6842%-122 - C6 -2HK8 - AROE_AQUAE A:[7-254] --QLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSL---KS-LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEGAKVF-LWNR----------T---K---EKAIKLAQKFP--------------LEVVNS---P-EE-VIDK-VQVIVNT--TSV---GL--K-----DEDPEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE--------------------------
24 PsiBlast_CBE 85.6042%-119 - C6 -2HK9 AROE_AQUAE B:[13-260] --QLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSL---KS-LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEGAKVF-LWNR----------T---K---EKAIKLAQKFP--------------LEVVNS---P-EE-VIDK-VQVIVNT--TSV---GL--K-----DEDPEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE--------------------------
7 PsiBlast_PDB 85.5342%-122 - C6 -2HK9 AROE_AQUAE A:[13-260] --QLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSL---KS-LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEGAKVF-LWNR----------T---K---EKAIKLAQKFP--------------LEVVNS---P-EE-VIDK-VQVIVNT--TSV---GL--K-----DEDPEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE--------------------------
2 PsiBlast_PDB 85.4742%-113 - C6 -3DON AROE_STAEQ A:[3-267] ----FAVIGNPISHSLSPLMHHANF----QSLNL----ENTYEAINVPVNQFQDIKKI-ISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVGAVNTV-LV-K--DG-KWIGYNTDGIGYVNGLK--QI-YEG-IEDAYILILGAGGASKGIAN-----------ELYKIVRPTLTVANR----------T---M---SRFNNWSL--------N---I---NKINLSH---A-ES-HLDE-FDIIINT--TP----------------DSV-I-S----LN----RLASHTLVS-DIVYN---PYKTPILIEAEQRGN-P-IYNGLDMFVHQGAESFKIWTNLE----PDIKA---MKNIVIQKLKG---
23 PsiBlast_CBE 84.7942%-116 - C6 -2HK9 AROE_AQUAE C:[13-260] --QLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSL---KS-LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEGAKVF-LWNR----------T---K---EKAIKLAQKFP--------------LEVVNS---P-EE-VIDK-VQVIVNT--TSV---GL--K-----DEDPEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE--------------------------
22 PsiBlast_CBE 84.4942%-114 - C6 -2HK9 AROE_AQUAE D:[13-260] --QLYGVIGFPVKHSLSPVFQNALI----RYAGL----NAVYLAFEINPEELKKAFEG-FKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTV-KF-E--NG-KAYGYNTDWIGFLKSL---KS-LIPEVKEKSILVLGAGGASRAVIY-----------ALVKEGAKVF-LWNR----------T---K---EKAIKLAQKFP--------------LEVVNS---P-EE-VIDK-VQVIVNT--TSV---GL--K-----DEDPEIF-N----YD----LIKKDHVVV-DIIYK-----ETKLLKKAKEKGA-K-LLDGLPMLLWQGIEAFKIWNGCE--------------------------
3 PsiBlast_PDB 84.2642%-116 - C6 -3DOO AROE_STAEQ A:[3-267] ----FAVIGNPISHSLSPLMHHANF----QSLNL----ENTYEAINVPVNQFQDIKKI-ISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVGAVNTV-LV-K--DG-KWIGYNTDGIGYVNGLK--QI-YEG-IEDAYILILGAGGASKGIAN-----------ELYKIVRPTLTVANR----------T---M---SRFNNWSL--------N---I---NKINLSH---A-ES-HLDE-FDIIINT--TP------------------V-I-S----LN----RLASHTLVS-DIVYN---PYKTPILIEAEQRGN-P-IYNGLDMFVHQGAESFKIWTNLE----PDIKA---MKNIVIQKLKG---
109 HHSearch 79.0043% -56 - C6 -1NVT AROE_METJA A:[10-283] KTKVIGLIGHPVEHSFSPIMHNAAF----KDKGL----NYVYVAFDVLPENLKYVIDG-AKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTI-KI-E--DG-KAIGYNTDGIGARMALE--E--EIGRVKDKNIVIYGAGGAARAVAF-----------ELAKDN--NIIIANR----------T---V---EKAEALAKEIAEKL--NKKFG---EEVKFSG---L-DV-DLDG-VDIIINA--TPI---GMY-P-----NIDVEPIVK----AE----KLREDMVVM-DLIYN---PLETVLLKEAKKVNA-K-TINGLGMLIYQGAVAFKIWTGVE----PNIEV---MKNAIID-------
36 PsiBlast_CBE 77.2734%-116 - C6 -5DZS ? B:[3-247] ---FFGLVGEKLSHSVSPQIHKRVF----EILNI----ESAYKNFEISKEDISKLDGA-IKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTI-LL-R--EN-MLYGYNTDYFG-LDSMF--KM-ANIDVQGKVAVILGTGGASKAALT-----------YFIDSGIEKLYVSTR----------K---K---DDKKLL----------N---S---KAILIDY---E-EL-KHIK-GDIILNA--TPV---GMY-P-----NVGISPV-S----KS----IIQNFDILI-DLIYN---PGETEFLRIGNSMGK-K-TCDGLYMLVGQAIKSQEIW------------------------------
106 HHSearch 77.0033%-100 * C6 *2D5C AROE_THET8 A:[1-261] -MLRFAVLGHPVAHSLSPAMHAFAL----ESLGL----EGSYEAWDTPLEALPGRLKE-VR-RAFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTV-LQ-V--EG-RLFGFNTDAPGFLEALK--A--GGIP-LKGPALVLGAGGAGRAVAF-----------ALREAG-LEVWVWNR----------T---P---QRALALAEEFGLRA---------------VP---L--E-KARE-ARLLVNA--TRV---GLE-D-----PS-ASPL-P----AE----LFPEEGAAV-DLVYR---PLWTRFLREAKAKGL-K-VQTGLPMLAWQGALAFRLWTGLL----PDPSG---MEEAARRAL-----
4 PsiBlast_PDB 75.9240% -55 - C6 -1NVT AROE_METJA A:[12-285] --KVIGLIGHPVEHSFSPIMHNAAF----KDKGL----NYVYVAFDVLPENLKYVIDG-AKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTI-KI-E--DG-KAIGYNTDGIGARMALE--EE-IGRVKDKNIVIYGAGGAARAVAFE-----------LAKDNN---IIIANR----------T---V---EKAEALAKEIAEKL--N---KKFGEEVKFSG---L-DV-DLDG-VDIIINA--TPI---GMY-P-----NIDVEPIVK----AE----KLREDMVVM-DLIYN---PLETVLLKEAKKVNA-K-TINGLGMLIYQGAVAFKIWTGVE----PNIEV---MKNAIIDKI-----
113 HHSearch 75.5834%-100 - C6 -3FBT ? A:[4-260] NTSIYGLIGEKLGHSHSSYIHKLIF----EKVGI----KGIYNLFEVPKEKLKESVDT-FKIIKCGGLNVTIPYKVEVMKELYEISEKARKIGAVNTL-KF-S--RE-GISGFNTDYIGFGKMLS--K--FRVEIKNNICVVLGSGGAARAVLQ-----------YLKDNFAKDIYVVTR----------N---P---EKTSEIYGEFKV--------------ISYDE---L-SN---LK-GDVIINC--TPK---GMY-P-----KEGESPV-D----KE----VVAKFSSAV-DLIYN---PVETLFLKYARESGV-K-AVNGLYMLVSQAAASEEIWNDIS----IDEII-----------------
104 HHSearch 75.5331%-106 - C6 -5DZS ? A:[1-270] -MNFFGLVGEKLSHSVSPQIHKRVF----EILNI----ESAYKNFEISKEDISKLDGA-IKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTI-LL-R--EN-MLYGYNTDYFGLDSMFK--M--ANIDVQGKVAVILGTGGASKAALT-----------YFIDSGIEKLYVSTR----------K---K----------SKAI--------------LIDYEE---L-K---HIK-GDIILNA--TPV---GMY-P-----NVGISPV-S----KS----IIQNFDILI-DLIYN---PGETEFLRIGNSMGK-K-TCDGLYMLVGQAIKSQEIWQDTK----IDNSILDVIYNELKLEFLG---
37 PsiBlast_CBE 75.4334%-114 - C6 -5DZS ? A:[3-247] ---FFGLVGEKLSHSVSPQIHKRVF----EILNI----ESAYKNFEISKEDISKLDGA-IKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTI-LL-R--EN-MLYGYNTDYFG-LDSMF--KM-ANIDVQGKVAVILGTGGASKAALT-----------YFIDSGIEKLYVSTR----------K---K-----------------------S---KAILIDY---E-EL-KHIK-GDIILNA--TPV---GMY-P-----NVGISPV-S----KS----IIQNFDILI-DLIYN---PGETEFLRIGNSMGK-K-TCDGLYMLVGQAIKSQEIW------------------------------
21 PsiBlast_CBE 75.4140% -60 - C6 -1NVT AROE_METJA B:[12-285] --KVIGLIGHPVEHSFSPIMHNAAF----KDKGL----NYVYVAFDVLPENLKYVIDG-AKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTI-KI-E--DG-KAIGYNTDGIGARMALE--EE-IGRVKDKNIVIYGAGGAARAVAFE-----------LAKDNN---IIIANR----------T---V---EKAEALAKEIAEKL--N---KKFGEEVKFSG---L-DV-DLDG-VDIIINA--TPI---GMY-P-----NIDVEPIVK----AE----KLREDMVVM-DLIYN---PLETVLLKEAKKVNA-K-TINGLGMLIYQGAVAFKIWTGVE----PNIEV---MKNAIIDKI-----
16 PsiBlast_PDB 74.5233% -44 - C6 -1O9B YDIB_ECOLI A:[8-283] --ELIGLMAYPIRHSLSPEMQNKAL----EKAGL----PFTYMAFEVDNDSFPGAIEG-LKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTI-VN-D--DG-YLRGYNTDGTGHIRAI---KE-SGFDIKGKTMVLLGAGGASTAIGA-----------QGAIEGLKEIKLFNRRDEFFDK---A---L---AFAQRVNENTDCVV--T---V---TDLADQQ---AFAE-ALAS-ADILTNG--TKV---GMK-PLENESLVNDISL-------------LHPGLLVT-ECVYN---PHMTKLLQQAQQAGC-K-TIDGYGMLLWQGAEQFTLWTGKD----FPLEY---VKQV----------
9 PsiBlast_PDB 74.0935% -51 - C6 -3TNL AROE_LISMO A:[38-315] --ELIGLIATPIRHSLSPTMHNEAF----AKLGL----DYVYLAFEVGDKELKDVVQG-FRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTV-VN-D--DG-VLTGHITDGTGYMRALK--EA-GHDIIGK-KMTICGAGGAATAICI-----------QAALDGVKEISIFNRKDDFYANAEKT---V---EKINSKTDC-------K---A---QLFDIED---H-EQLRKEI-AESVIFTNATGV---GMK-P-----FEGETLLPS----AD----MLRPELIVS-DVVYK---PTKTRLLEIAEEQGC-Q-TLNGLGMMLWQGAKAFEIWTHKE----MPVDY---IKEILF--------
34 PsiBlast_CBE 73.7835% -50 - C6 -3TNL AROE_LISMO C:[38-315] --ELIGLIATPIRHSLSPTMHNEAF----AKLGL----DYVYLAFEVGDKELKDVVQG-FRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTV-VN-D--DG-VLTGHITDGTGYMRALK--EA-GHDIIGK-KMTICGAGGAATAICI-----------QAALDGVKEISIFNRKDDFYANAEKT---V---EKINSKTDC-------K---A---QLFDIED---H-EQLRKEI-AESVIFTNATGV---GMK-P-----FEGETLLPS----AD----MLRPELIVS-DVVYK---PTKTRLLEIAEEQGC-Q-TLNGLGMMLWQGAKAFEIWTHKE----MPVDY---IKEILF--------
102 HHSearch 73.6134% -38 - C6 -3TNL AROE_LISMO A:[36-314] HTELIGLIATPIRHSLSPTMHNEAF----AKLGL----DYVYLAFEVGDKELKDVVQG-FRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTV-VN-D--DG-VLTGHITDGTGYMRALK--E--AGHDIIGKKMTICGAGGAATAICI-----------QAALDGVKEISIFNR----------K---DDFYANAEKTVEKINSKTDCK---AQLFDIEDHEQ---L-RK-EIAE-SVIFTNA--TGV---GMK-P-----FEGETLL-PS---AD----MLRPELIVS-DVVYK---PTKTRLLEIAEEQGC-Q-TLNGLGMMLWQGAKAFEIWTHKE----MPVDY---IKEIL---------
35 PsiBlast_CBE 73.1235% -47 - C6 -3TNL AROE_LISMO B:[38-315] --ELIGLIATPIRHSLSPTMHNEAF----AKLGL----DYVYLAFEVGDKELKDVVQG-FRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTV-VN-D--DG-VLTGHITDGTGYMRALK--EA-GHDIIGK-KMTICGAGGAATAICI-----------QAALDGVKEISIFNRKDDFYANAEKT---V---EKINSKTDC-------K---A---QLFDIED---H-EQLRKEI-AESVIFTNATGV---GMK-P-----FEGETLLPS----AD----MLRPELIVS-DVVYK---PTKTRLLEIAEEQGC-Q-TLNGLGMMLWQGAKAFEIWTHKE----MPVDY---IKEILF--------
33 PsiBlast_CBE 72.9135% -48 - C6 -3TNL AROE_LISMO D:[38-315] --ELIGLIATPIRHSLSPTMHNEAF----AKLGL----DYVYLAFEVGDKELKDVVQG-FRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTV-VN-D--DG-VLTGHITDGTGYMRALK--EA-GHDIIGK-KMTICGAGGAATAICI-----------QAALDGVKEISIFNRKDDFYANAEKT---V---EKINSKTDC-------K---A---QLFDIED---H-EQLRKEI-AESVIFTNATGV---GMK-P-----FEGETLLPS----AD----MLRPELIVS-DVVYK---PTKTRLLEIAEEQGC-Q-TLNGLGMMLWQGAKAFEIWTHKE----MPVDY---IKEILF--------
54 PsiBlast_CBE 72.8734% -40 - C6 -1NYT AROE_ECOLI C:[4-262] ----YAVFGNPIAHSKSPFIHQQFA----QQLNI----EHPYGRVLAPINDFINTLNA-FFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTL-MRLE--DG-RLLGDNTDGVGLLSDLE--RLSFIRP--GLRILLIGAGGASRGVLL-----------PLL-SLDCAVTITNR----------T---V---SRAEELAKLFAHTG--S---I---QALSMDE---L-EG---HE-FDLIINA--TSS---GIS-G-----DIPAIPS-S----L-------IHPGIYCYDMFYQ---KGKTPFLAWCEQRGS-KRNADGLGMLVAQAAHAFLLWHGVL----PDVEP---V-------------
53 PsiBlast_CBE 72.6934% -44 - C6 -1NYT AROE_ECOLI D:[4-262] ----YAVFGNPIAHSKSPFIHQQFA----QQLNI----EHPYGRVLAPINDFINTLNA-FFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTL-MRLE--DG-RLLGDNTDGVGLLSDLE--RLSFIRP--GLRILLIGAGGASRGVLL-----------PLL-SLDCAVTITNR----------T---V---SRAEELAKLFAHTG--S---I---QALSMDE---L-EG---HE-FDLIINA--TSS---GIS-G-----DIPAIPS-S----L-------IHPGIYCYDMFYQ---KGKTPFLAWCEQRGS-KRNADGLGMLVAQAAHAFLLWHGVL----PDVEP---V-------------
55 PsiBlast_CBE 72.6234% -40 - C6 -1NYT AROE_ECOLI B:[4-262] ----YAVFGNPIAHSKSPFIHQQFA----QQLNI----EHPYGRVLAPINDFINTLNA-FFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTL-MRLE--DG-RLLGDNTDGVGLLSDLE--RLSFIRP--GLRILLIGAGGASRGVLL-----------PLL-SLDCAVTITNR----------T---V---SRAEELAKLFAHTG--S---I---QALSMDE---L-EG---HE-FDLIINA--TSS---GIS-G-----DIPAIPS-S----L-------IHPGIYCYDMFYQ---KGKTPFLAWCEQRGS-KRNADGLGMLVAQAAHAFLLWHGVL----PDVEP---V-------------
56 PsiBlast_CBE 72.3834% -39 - C6 -1NYT AROE_ECOLI A:[4-262] ----YAVFGNPIAHSKSPFIHQQFA----QQLNI----EHPYGRVLAPINDFINTLNA-FFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTL-MRLE--DG-RLLGDNTDGVGLLSDLE--RLSFIRP--GLRILLIGAGGASRGVLL-----------PLL-SLDCAVTITNR----------T---V---SRAEELAKLFAHTG--S---I---QALSMDE---L-EG---HE-FDLIINA--TSS---GIS-G-----DIPAIPS-S----L-------IHPGIYCYDMFYQ---KGKTPFLAWCEQRGS-KRNADGLGMLVAQAAHAFLLWHGVL----PDVEP---V-------------
107 HHSearch 71.5533% -44 - C6 -1NYT AROE_ECOLI A:[1-270] -METYAVFGNPIAHSKSPFIHQQFA----QQLNI----EHPYGRVLAPINDFINTLNA-FFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTL-MRLE--DG-RLLGDNTDGVGLLSDLE--R--LSFIRPGLRILLIGAGGASRGVLL-----------PLLSLD-CAVTITNR----------T---V---SRAEELAKLFAHTG--S---I---QALSMDE---L-E---GHE-FDLIINA--TSS---GIS-G-----DI--PAI-P----SS----LIHPGIYCY-DMFYQ---KGKTPFLAWCEQRGSKR-NADGLGMLVAQAAHAFLLWHGVL----PDVEP---VIKQLQEEL-----
101 HHSearch 71.3232% -42 - C6 -3T4E YDIB_SALTY A:[30-310] KYELIGLMAYPIRHSLSPEMQNKAL----EKAGL----PYTYMAFEVDNTTFASAIEG-LKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTI-VN-D--DG-YLRGYNTDGTGHIRAIK--E--SGFDMRGKTMVLLGAGGAATAIGA-----------QAAIEGIKEIKLFNR----------K---DDFFEKAVAFAKRVNENT--DCV-V---TVTDLADQHAF-TE-ALAS-ADILTNG--TKV---GMK-P-----LENESLIGD----VS----LLRPELLVT-ECVYN---PHMTKLLQQAQQAGC-K-TIDGYGMLLWQGAEQFELWTGKA----FPLDY---VKQVMGF-------
45 PsiBlast_CBE 70.4437% -34 - C6 -3PGJ AROE_VIBCH C:[32-290] ----YAVFGNPINHSKSPFIHTLFA----RQTQQ----SMIYTAQCVPVDGFTEAAKH-FFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTL-KK-L--DDGEILGDNTDGEGLVQDLLAQQV-LLKGA---TILLIGAGGAARGVLK-----------PLLDQQPASITVTNR----------T---F---AKAEQLAELVAAYG--E---V---KA----Q---A-FE-QLKQSYDVIINS--TS--------P-----AIDPVIF-S-------------SRSVCY-DMMYG---KGYTVFNQWARQHGCAQ-AIDGLGMLVGQAAESFMLWRGLR----PGTKQ---I-------------
43 PsiBlast_CBE 70.2937% -32 - C6 -3SEF AROE_VIBCH B:[32-290] ----YAVFG---NHSKSPFIHTLFA----RQTQQ----SMIYTAQCVPVDGFTEAAKH-FFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTL-KK-L--DDGEILGDNTDGEGLVQDLLAQQV-LLKGA---TILLIGAGGAARGVLK-----------PLLDQQPASITVTNR----------T---F---AKAEQLAELVAAYG--E---V---KA----Q---A-FE-QLKQSYDVIINS--TSASLDGEL-P-----AIDPVIF-S-------------SRSVCY-DMMYG---KGYTVFNQWARQHGCAQ-AIDGLGMLVGQAAESFMLWRGLR----PGTKQ---I-------------
48 PsiBlast_CBE 70.1632% -88 - C6 -2D5C AROE_THET8 B:[4-262] ----FAVLGHPVAHSLSPAMHAFAL----ESLGL----EGSYEAWDTPLEALPGRLKE-VRR-AFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTV-LQ-V--EG-RLFGFNTDAPGFLEAL---KA-GGIPLKGPALVLGAG--GAGRAVA-----------FALREAGLEVWVWNR----------T---P---QRALALAE---EFG--L---R---AVPLEKA---R-EA-RL------LVNA--TRV---GL---------ASPLPA-E----LF----PEEGAAV---DLVYR---PLWTRFLREAKAKGL-K-VQTGLPMLAWQGALAFRLWTGLL----PDPSG---MEEAARRALG----